(data stored in ACNUC29543 zone)

EMBL: CP000521.PE655

CP000521.PE655       Location/Qualifiers
FT   CDS_pept        complement(738105..738575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3535"
FT                   /old_locus_tag="AS1_3535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89960"
FT                   /protein_id="ABS89960.2"
FT                   /translation="MKIVPSIRRSLTVLCISVATLTGCQSYYYVPSPKFDVESPLGILS
FT                   QAAQDAVAEQQTYALDKKAFNEDLALRQRSFRTDVIRVDYVGEPQTLLQSAAYHFGYRF
FT                   IEAGNIHQLPIVNFSKRKLTGFDLIKDVGLQLGNSATVDVDENDKTITLIHR"
     atgaaaatag taccttcaat tcgtcgttca ctcactgttc tttgtatctc tgttgccact        60
     ttgactggat gccaaagcta ctactacgtt ccaagcccta aatttgatgt tgaatcgcct       120
     ttaggtattt tgagtcaagc tgctcaagat gctgtagccg aacaacaaac ttatgcccta       180
     gataaaaaag cctttaacga agatttagct ttacgccaac gtagctttag aactgacgtt       240
     attcgtgttg actatgtcgg ggaacctcag accctccttc aaagtgcagc ttatcacttc       300
     ggatatcgct ttattgaagc tggtaacatt catcagctcc caatcgtaaa cttcagcaaa       360
     cgcaaattaa ctggatttga tctcattaaa gatgttggct tgcaacttgg taactctgca       420
     actgttgatg tagatgaaaa tgataaaaca atcacattga tccatcgtta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page