(data stored in ACNUC29543 zone)

EMBL: CP000521.PE658

CP000521.PE658       Location/Qualifiers
FT   CDS_pept        742373..742675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3538"
FT                   /old_locus_tag="AS1_3538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89963"
FT                   /protein_id="ABS89963.2"
FT                   /translation="MKTDDVIEHIEKQNVTAVELLDEFDPNLQFKFAKAMTALKQVIDD
FT                   VRILYPDASYYIQDDAFYLMLGDSHSGDHKQNANTNLIALTDNHKLAGCISGGGF"
     atgaaaacag atgatgttat tgaacacatc gaaaaacaaa atgtgacagc agtagaatta        60
     ctcgatgagt ttgatccgaa cttgcaattc aaattcgcta aagcaatgac ggcgttaaaa       120
     caggttattg atgatgttcg gattctttat ccagatgcct cttactacat tcaagatgat       180
     gctttttatc taatgctagg agatagccat tctggtgatc ataaacagaa tgcaaataca       240
     aatttaattg cattgactga taatcataaa ttggcagggt gtatctctgg tggaggattc       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page