(data stored in ACNUC29543 zone)

EMBL: CP000521.PE660

CP000521.PE660       Location/Qualifiers
FT   CDS_pept        744711..745841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11094"
FT                   /protein_id="ABO11094.2"
FT                   /translation="MQLKFKNLALSMALVVAGSSYAEPSQQQSGQQQQATAQQTVPSSQ
FT                   PQGNNQSQGNNQQQGQQQANNQQAQAEAPSYIGTPPPNTINLGNVQTFGNSFPPPVRVA
FT                   KTKDEIVAEILSMELTPQQVKNIKDLLLRQERDASTPYTTTARPIVRSVPIDLSPAAQP
FT                   PVLRLSMGMLTSIVFSDLSGNPWEIEKVTFNKELFADDRPEQGQGQGEKSDISSKNTNI
FT                   FSIEPLTATAYGNVTVRLKGLSTPVIFILATGQNEVDMRIDARLAGRSPTSVNSSLRAN
FT                   MNATGVMSSIDSQTLLFLDGTPPVEAERIRTSDTSVEAWNFNGQYIVRSNDTVLYPSYK
FT                   STARSTGGTSIYVYPDPINQVTISRNGQPTTVYFNN"
     atgcagctaa agtttaaaaa tcttgcactg agtatggcgc tagtcgttgc tggtagttct        60
     tatgctgaac caagccaaca acaatcaggc cagcaacagc aagctacggc gcagcaaact       120
     gtgccttctt ctcaaccaca gggtaataac caatctcaag ggaataacca gcaacaaggt       180
     caacagcaag ccaataatca acaggctcaa gctgaagcgc cttcgtatat tggaacacct       240
     ccaccaaata cgattaattt aggtaatgtt caaacttttg gtaattcgtt cccaccacca       300
     gtacgtgtag cgaaaactaa agatgagatt gttgctgaaa ttttaagtat ggaacttacc       360
     ccgcaacagg ttaaaaacat caaggatctg ctcttacgtc aagagcggga tgcttctaca       420
     ccatatacga caacggcgcg accaattgta cgctctgttc caattgattt gagcccagca       480
     gctcaaccgc cagtcttacg gctttctatg ggaatgttaa ccagtattgt ttttagcgat       540
     ctgagtggta atccgtggga aattgaaaaa gttacgttca acaaagaact gtttgcagac       600
     gacagaccag aacaagggca gggtcaaggt gaaaaatctg atatttcatc taaaaacacg       660
     aacatatttt caattgaacc tcttaccgct accgcttacg gaaacgtgac agtacgttta       720
     aaaggtttat caacaccagt aattttcatt ttagccactg gtcaaaatga agtggatatg       780
     cgtattgatg cgcgactagc tgggcgtagt ccaacatctg tcaactcttc gttacgcgca       840
     aatatgaatg ccactggcgt tatgtcgagt attgatagtc agacactact atttctagat       900
     ggtacgcctc cagtagaagc agaacgcatt agaacttcag atacaagtgt tgaagcttgg       960
     aattttaacg gtcaatacat tgttcgtagt aacgatacag tgctttaccc aagttataaa      1020
     tcaacagcac gttcaacagg cggcacaagt atttatgtct atccggatcc tattaatcag      1080
     gtaacgatta gtagaaacgg acaaccgact acagtgtatt ttaataatta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page