(data stored in ACNUC29543 zone)

EMBL: CP000521.PE663

CP000521.PE663       Location/Qualifiers
FT   CDS_pept        748400..748978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3542"
FT                   /old_locus_tag="AS1_3542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89967"
FT                   /protein_id="ABS89967.2"
FT                   /translation="METIDILQNMGFFFVAATELLRYFFVVSGFYIFLHALVDFVQISQ
FT                   PALAGRFMTQIRRPSAFGASMKLIIAAFLCTLGLRLQLLDIVGSLISDTTPAGVTYYDY
FT                   TQYTGSSYTDELNLAVLVIIGVLQFFGLLAIGRGLWIWRDNADGIAKLSVGQGTMFMIG
FT                   GMLAYKVEVVHAFLASWFGLDFFKIIGLT"
     atggaaacta tagatatttt gcaaaatatg ggtttcttct tcgtagcagc taccgaattg        60
     cttcgatact tctttgtagt gtctggtttt tacatatttc ttcatgcgct ggttgatttt       120
     gttcaaattt cacaaccagc tttagcagga cgatttatga ctcaaatacg ccgaccaagc       180
     gcatttgggg catcgatgaa acttattatc gcagcgtttc tttgtacgtt gggtttaaga       240
     cttcagttgc tagacatcgt tgggtcactc attagtgaca caacaccagc aggggtaact       300
     tattacgatt acacacagta cacaggcagc tcttatacag acgagctcaa cttagcagta       360
     ttggtaatca tcggggtttt acaatttttt ggattattag ccattggtcg tggtctatgg       420
     atctggcgcg ataatgctga cggcattgcc aaattgtctg taggtcaagg aacaatgttc       480
     atgataggag gaatgttagc ttataaagtt gaagttgtgc acgcattttt agcgtcgtgg       540
     tttggcttag actttttcaa aatcataggc ttaacctag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page