(data stored in ACNUC29543 zone)

EMBL: CP000521.PE664

CP000521.PE664       Location/Qualifiers
FT   CDS_pept        749083..749502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3543"
FT                   /old_locus_tag="AS1_3543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89968"
FT                   /protein_id="ABS89968.2"
FT                   /translation="MSKINNLQKVKNVGQDIYAQLGVAFTMGSLGITNAIAAPDTTNLT
FT                   GGNRQGQATGGDSVGDIRDRGINAMDAFMSFLQYAGMLVGFIVFVMGVIDFLNIGKPGK
FT                   DATAGKAGLKLLIGAVLAGAGYFYWSAANSASGNV"
     atgagcaaaa tcaataactt acagaaagta aaaaacgttg gtcaagatat ctatgcacaa        60
     cttggcgttg ctttcactat gggttcatta ggtattacta atgcgattgc ggctccagat       120
     actaccaatc taactggtgg taatcgtcag ggacaagcaa caggtggtga ctctgtgggt       180
     gacatccgtg atcgtggtat taacgcaatg gatgcattca tgtcattcct tcaatatgcg       240
     ggaatgttag ttggtttcat cgttttcgta atgggtgtta tcgacttctt aaatatcggt       300
     aagccgggta aagatgccac tgctggtaaa gctggattga agctcttgat tggtgctgtt       360
     ttagcgggtg ctggttactt ctactggtct gctgcgaact ctgcctctgg caacgtctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page