(data stored in ACNUC29543 zone)

EMBL: CP000521.PE665

CP000521.PE665       Location/Qualifiers
FT   CDS_pept        749581..750339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3544"
FT                   /old_locus_tag="AS1_3544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89969"
FT                   /protein_id="ABS89969.2"
FT                   /translation="MINKSIQLDTIGDTEKFLHALKIDSSSFFKKHDHRCYFCDFRDLR
FT                   FLEVHHLDGNHNNNNESNLVPACTLCHRAHHLAWVLTDRSGLLGICHELDQIRINHLQR
FT                   FVLVLANHPDPKLKAFFIKGGMFQTVLDNIAMEYYRPDVDEKTIRESIDSEFPQATIDL
FT                   KESLFTDRINAIYVRQSLSSNDGLERLIYAINEVKQSNKTIAPNAFFPFVLLYNQNIFS
FT                   KEQIDYYLSLDEFNPEKWTQLFEEQLLKAG"
     atgataaaca aaagcattca actcgatacc ataggtgata ctgagaagtt tttacatgct        60
     ttaaaaattg attcttcttc ctttttcaaa aagcatgacc atcgttgcta tttttgtgat       120
     tttcgggatc ttcgttttct tgaggtccac catctagatg gaaatcacaa caataataat       180
     gagtcgaatc ttgtgccagc ttgtacttta tgtcatcgag cgcatcattt agcttgggtg       240
     ctaacagatc gttcggggtt gttaggtata tgtcatgagt tggaccagat cagaattaat       300
     catctacaac gttttgttct ggttttagct aaccatccgg atcctaagct gaaggcattt       360
     tttatcaagg gtgggatgtt ccagaccgta cttgataata ttgcaatgga gtattaccgt       420
     ccggatgttg atgagaagac gattcgtgaa agtatcgatt ctgaattccc tcaagcaacg       480
     attgatttaa aagaatcact ctttactgac cgtattaatg caatttatgt gagacagtct       540
     ctatcatcaa atgatgggtt agaacgcctc atttatgcaa ttaatgaggt taagcagagt       600
     aataagacga tagcgccgaa tgcgtttttc ccgtttgttc tgttatataa ccaaaatatc       660
     ttttctaaag agcaaattga ttattacctt tcattagatg agtttaatcc ggagaagtgg       720
     actcagcttt ttgaagaaca acttcttaaa gccggttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page