(data stored in ACNUC29543 zone)

EMBL: CP000521.PE671

CP000521.PE671       Location/Qualifiers
FT   CDS_pept        756694..757866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3548"
FT                   /old_locus_tag="AS1_3548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89973"
FT                   /protein_id="ABS89973.2"
FT                   /translation="MDQVTQSVVNGYNIASSAMGINYQSSTNVNIEKQDRISYQDIASQ
FT                   QEGQFTIVVAKKIDGGKEGGVFAIHAQTMFVQPPKLAKIRLNDFVSIEKELTYFDSKKY
FT                   DNELKNFAYQLAENKILQSCPNYKKHAIGALNQVDTHLESISKMAKLYETDVKSGFFAI
FT                   MRTMQNMLDSVQISGFSAPFYEVVDSTFANEIDGALDSIFTEIKLDTEEVDVVLNKTID
FT                   HIQDERSQDLLTKTSETIIDEIVDQYLNLDSSEIETIEAVNAYIEALPNVYDDQLYSEE
FT                   FATTVREHLKQHDIYIQSLDIPSFEDLLELDQCAAEAQKSIFSDDFEEDDLFSDAQERY
FT                   NYVTDFIKCKNLVFEEKEKEIESEDQEILSKLEKYHEIVYRMISAKLKDK"
     gtggaccaag tgacacagtc agtagtaaac ggctacaaca ttgcttcttc agcaatggga        60
     ataaattatc aatcttctac aaacgttaat atcgaaaagc aggaccgaat tagttatcag       120
     gatattgcat cacaacaaga aggtcagttc acgatcgtag ttgctaaaaa gatcgatggt       180
     ggtaaagagg gcggtgtatt cgctattcat gctcaaacaa tgtttgtaca accacctaaa       240
     ctagcaaaga tccggttaaa tgattttgtt tcgattgaaa aagagctgac ctattttgat       300
     agtaagaaat atgataatga gcttaaaaac tttgcttatc agttagcaga gaacaagatc       360
     cttcaaagtt gtccaaatta taaaaaacat gccattggtg ctctaaatca ggtcgatact       420
     caccttgaaa gtatcagtaa aatggcgaaa ttatacgaga ctgatgttaa gtccggtttc       480
     ttcgcaatta tgcgtacaat gcaaaatatg ctggattcag ttcaaatatc tggctttagt       540
     gctccttttt atgaagttgt tgattcaact tttgcaaatg agatcgatgg agctctagat       600
     tcaatattta ctgaaattaa acttgatact gaagaagtcg atgttgtttt aaataaaaca       660
     attgatcaca ttcaggatga acgttctcag gatctattaa caaaaactag cgaaacaatt       720
     atcgatgaga tcgtcgatca atacctaaat ttagattcaa gcgaaataga gacaatagaa       780
     gctgttaatg catatatcga agcacttcca aacgtttacg atgaccaact ttatagcgaa       840
     gagtttgcaa caacggttag agagcattta aagcagcatg atatctatat tcaatcgtta       900
     gacattccat cattcgaaga cttattagaa cttgatcaat gtgcggccga agctcaaaag       960
     agtatcttca gtgatgattt tgaagaagat gatttatttt cagatgctca agagcgatac      1020
     aactatgtaa ccgacttcat taaatgcaaa aacttagttt ttgaagaaaa ggaaaaggaa      1080
     atcgaatctg aagatcagga gatcttgagc aagctggaga agtatcacga aattgtatat      1140
     cgcatgatta gtgcgaagct taaagataaa taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page