(data stored in ACNUC29543 zone)

EMBL: CP000521.PE674

CP000521.PE674       Location/Qualifiers
FT   CDS_pept        complement(760150..760611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11097"
FT                   /protein_id="ABO11097.1"
FT                   /translation="MKNIFVLSLALLGAPVAYADFQGKVIKVADGDTLTVLVNGNTQER
FT                   VRLENIDAPESSQAYGQQARNFLNSQVYGKFVYVKSNKMDLYKRHIGTIYLGNYNINQS
FT                   IVQNGYAWAFREYLTDPNYIKYEQYARQNRLGLWKDNNPIYPSNWRRSK"
     atgaagaata tttttgtttt atcactagct cttttagggg cacccgttgc atatgcagat        60
     tttcaaggca aagttattaa agtcgctgat ggagatactc ttaccgttct agtaaacgga       120
     aatacacaag aacgagttcg tctggagaat atagatgctc ctgagtcttc acaagcatac       180
     ggccagcaag cacgaaattt cttaaatagt caggtttatg gaaagttcgt atatgttaag       240
     tctaataaaa tggatttata taaacgccat atcgggacta tatatcttgg aaattacaac       300
     attaaccagt caattgttca aaatggttat gcatgggcat ttcgtgaata tttaacggat       360
     cctaattata ttaagtatga gcaatacgct agacaaaaca gattaggttt atggaaagac       420
     aacaatccta tatatcctag caattggaga agatctaagt ag                          462
//

If you have problems or comments...

PBIL Back to PBIL home page