(data stored in ACNUC29543 zone)

EMBL: CP000521.PE675

CP000521.PE675       Location/Qualifiers
FT   CDS_pept        761009..761101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3551"
FT                   /old_locus_tag="AS1_3551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89976"
FT                   /protein_id="ABS89976.1"
FT                   /translation="MAHGTGLLSDQKLCLRSKQNAEAKLNRFGP"
     ttggctcatg gtactggttt actaagcgat caaaaacttt gcctaagatc aaaacaaaat        60
     gctgaagcga agctaaatcg ttttggtcct taa                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page