(data stored in ACNUC29543 zone)

EMBL: CP000521.PE680

CP000521.PE680       Location/Qualifiers
FT   CDS_pept        complement(768039..768803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3554"
FT                   /old_locus_tag="AS1_3554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89979"
FT                   /protein_id="ABS89979.1"
FT                   /translation="MYGECIATVLVATPEEISIPDDDNLILNISLYNIFNLQNSHHYNE
FT                   KQIGIEIQHCIKNFTPAHTDLSASSRDLINEQLSKMLVIANAVQKTVEEKELFKDGEQF
FT                   IALDLKGNPIVFNSTNAINNRISLGYGIVDAHDHLLTTFSGHLKTENIVRFLECLAQSQ
FT                   SNIENYYNNFLSNRILSFLDGTLNFLDCSDPEFALEKCRKLYEESKSALLDIIDEICIS
FT                   DLNKFLFNQFEKSINYVCLDFKDNLQDYCRLR"
     atgtatggtg agtgtatagc aaccgtttta gtcgctactc cagaagagat ttcgattcct        60
     gatgatgaca atttaatctt aaatatctcg ttgtataaca tcttcaatct acagaattca       120
     catcactata atgagaaaca aattggcatt gaaattcagc actgtataaa aaatttcact       180
     ccggcgcata cagacctttc tgcatcttca agagatctta ttaacgagca actgtcaaaa       240
     atgttagtga ttgccaatgc cgtacaaaaa actgttgaag aaaaggaact gtttaaagat       300
     ggtgagcaat ttattgcact ggatctaaaa ggcaatccta tagtgttcaa ttctacaaat       360
     gcaattaata atcgtattag tttaggttat ggaattgttg atgcacatga tcatctttta       420
     actaccttca gtggtcattt aaaaactgaa aatatagttc gttttttgga gtgcttagca       480
     caatcacaaa gcaatattga aaactattac aacaacttct tatcaaacag aattttatcc       540
     ttcttggatg gcacgctaaa cttcttagat tgttcagatc cggagtttgc attagagaaa       600
     tgtcgtaaac tttatgaaga gtctaaatcg gctttattag acataattga tgaaatatgt       660
     atttctgatt taaataagtt tctttttaac cagtttgaaa aatctataaa ttatgtatgt       720
     ctagatttta aagataacct tcaggattat tgccgcttaa gataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page