(data stored in ACNUC29543 zone)

EMBL: CP000521.PE682

CP000521.PE682       Location/Qualifiers
FT   CDS_pept        770543..772804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0651"
FT                   /product="TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11100"
FT                   /protein_id="ABO11100.2"
FT                   /translation="MTDLVIVESSNKVDSIQGYLDSLFGRGKFKVSFSKGHIRDLPKDS
FT                   LGLTAEYTPNYVFNDSGASRVRELKALVEKSQKVYLATDPDREGEAIAWHLKTVLRLNE
FT                   NYGRVTFQEITKTAVAQAMGNERKLNMQVVQAQETRRILDRIIGYIGTPAFTLICGEKQ
FT                   IAGRVQSSIVWYLVDLENKIKQFSSVLHFGVTFNFGSVDESWEAKWDTSNFITKLDPFV
FT                   IDRKLAEEVSKLREFTVETFEEKPEKSSPPAPFTTPTYLRAAHVQLKLKTKRAMEIAQK
FT                   LFEDGHITYIRTDSPNLSDDAIQAIREFALKNKLPIPATPRKFKSKALAQEGHEAIRPT
FT                   DFNQLKVSDDSTIQAVYQMIWLRSVACQLDDATFTARIVRMKGRQLVQGREVFVKARGR
FT                   KLIDQGWLRLTAKLNFSEDENEDIPEDAAQELNNPVPLLQKAGNLVALKSDLNEKRTEP
FT                   PRRHSEASLIKFMEDVGIGRPSTFVSIVSKIIDHGYVHLDSKNKIHATDLAQRLVGKIS
FT                   NQFEFCNLKYTAELEGKLDLIAHGENIGKRLLKETHLKIETQAKESIKNLDQGGPKQYC
FT                   SKCSEQLVNMTSANGKPYFKCTNLKCGHMMMNQDGIAIDRESLTSEFKCIVCESGLISR
FT                   SGQNGEFFGCSGFFKKRNKCTASYQKKPDGTPDYQAFLAKRELKESKQEQGEKPVPKNT
FT                   EKKEKEFNCPECKALLQQRTGKSKTTNKKWEIWSCSSPNCKNEYWGERNKPIFDKKIVK
FT                   "
     atgactgatt tagttatcgt agagtcatct aataaggttg actctataca gggctatcta        60
     gatagccttt ttggtcgagg taaatttaaa gtttcattta gtaagggcca tatacgtgac       120
     ttacccaaag actcactagg attaactgcc gaatatacac ctaactatgt gtttaatgat       180
     tctggtgcaa gtcgtgtaag agagctaaaa gcattagttg agaaatcaca aaaagtatat       240
     cttgctacgg atccggatcg agaaggtgag gctattgcat ggcatcttaa aacggttctc       300
     cggcttaacg aaaattatgg tcgagttaca tttcaggaga ttacaaagac agcagtagca       360
     caagctatgg gtaacgagcg taagttaaat atgcaagttg ttcaagcaca agaaacacga       420
     agaattctag accgaattat tggatacatt ggaacaccgg cttttacttt aatatgtggt       480
     gaaaaacaga ttgctggtcg agttcaaagt agtatcgtat ggtatctagt cgatcttgaa       540
     aataagatca aacaattctc gtcagttttg cattttggtg taactttcaa ttttggttct       600
     gtagatgagt cttgggaagc aaaatgggat acatcaaatt tcataactaa gttagatcct       660
     tttgtaattg atcgaaagct tgctgaagaa gtttcaaaat tacgtgaatt cactgtagaa       720
     acttttgaag aaaaaccaga gaaaagctct ccaccggctc cttttacaac tcctacttat       780
     ctacgggccg cacacgttca attaaaactt aaaacgaaaa gagcaatgga aattgctcaa       840
     aaattatttg aagatggcca tataacatac attcgtactg acagcccaaa tttaagtgat       900
     gatgccattc aagctattcg tgaatttgca ctgaagaaca aattacctat accggcaaca       960
     ccacgaaaat ttaaatctaa agctttggct caagaaggcc atgaagctat cagaccgact      1020
     gattttaatc aattaaaagt atcagatgat tcaaccattc aggcggtata tcaaatgatc      1080
     tggttgcgtt cagtggcttg tcagcttgat gatgcgacat tcacagcgcg tattgtccgt      1140
     atgaaaggtc gccagttagt gcaaggtcga gaagtctttg ttaaagctcg tggacgtaaa      1200
     ctaattgatc aaggctggtt acgacttaca gcaaagctaa acttttctga agacgagaat      1260
     gaagatattc cggaagacgc tgcacaagag ttgaataatc cagtgccgtt attacaaaag      1320
     gcagggaatt tagttgcatt aaaatcagat ctgaatgaga aaagaaccga acccccacgt      1380
     aggcattctg aagctagtct cattaagttc atggaagatg tgggtatagg tcgcccatca      1440
     actttcgtaa gcatcgtttc taaaattatt gatcatggtt atgtacactt agacagtaaa      1500
     aataaaatac atgctactga tctggctcaa agattggttg ggaaaatttc aaaccaattt      1560
     gaattttgca atctcaaata tacagcagag ttagaaggaa agttggatct cattgcacat      1620
     ggtgaaaaca ttggtaagag gctattaaaa gagacacatc tcaaaattga aacccaagca      1680
     aaagagtcta ttaaaaattt agatcaaggt ggacctaaac aatattgttc taagtgctca      1740
     gaacaattgg tgaatatgac aagtgcgaac ggtaagcctt atttcaaatg tacaaatttg      1800
     aagtgtggtc acatgatgat gaatcaagat gggatagcaa ttgatagaga atcgcttaca      1860
     tcagaattta agtgcattgt gtgcgagagt ggcctaattt cgcgttcagg ccaaaatggt      1920
     gagttctttg gatgctcagg tttcttcaag aagagaaata aatgtacagc cagttatcaa      1980
     aagaaaccag acggtacacc tgactatcaa gcattccttg ccaaaaggga gctgaaggaa      2040
     tctaagcaag aacaaggtga aaaacctgtt cctaaaaata cagagaaaaa ggaaaaagaa      2100
     tttaactgtc cggagtgtaa agctctactc caacaacgta ctggtaaatc aaaaacaaca      2160
     aacaagaagt gggagatttg gtcgtgttct tcccctaatt gtaaaaatga atattggggt      2220
     gagcgaaaca aaccaatttt cgataaaaag atcgttaaat ga                         2262
//

If you have problems or comments...

PBIL Back to PBIL home page