(data stored in ACNUC29543 zone)

EMBL: CP000521.PE685

CP000521.PE685       Location/Qualifiers
FT   CDS_pept        775999..776232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0652"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11101"
FT                   /protein_id="ABO11101.1"
FT                   /translation="MYLSDLNAQQRAIVTKVQASLILSNRLETLGFIPQAEVRVITKGI
FT                   FGGDPILVQIGFTRFALRKSEAKCIYVEGLNS"
     atgtacttat ctgatttaaa cgcacaacaa agggctatcg taacgaaagt tcaagcttct        60
     ttaatcttat caaatcgtct agaaacatta ggttttattc cacaagcaga agttcgtgtc       120
     attactaaag gaatctttgg tggtgaccct attctcgttc aaattggatt tactcgtttt       180
     gctttaagaa agtcagaagc taaatgtatt tatgttgaag gacttaattc atga             234
//

If you have problems or comments...

PBIL Back to PBIL home page