(data stored in ACNUC29543 zone)

EMBL: CP000521.PE686

CP000521.PE686       Location/Qualifiers
FT   CDS_pept        776229..778076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0653"
FT                   /product="putative ferrous iron transport protein B"
FT                   /note="FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11102"
FT                   /protein_id="ABO11102.1"
FT                   /translation="MTTDLRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVEKKVGH
FT                   FTLPSSNKVRILDLPGTYSLSATSPDEAITRDVCNGLTEEAQQDAFICVVDATNLKLHL
FT                   GLVLEVLALGRPVLVVLNMMDEARRRGIQINIEKLSQHLGVPVVETVAVKSSGLTQLID
FT                   ALDKEVFHTPHTDFTAKIDSPQKHIEYVLATTITDQGKVDTRTEFLDKILLHPIAGLLI
FT                   LAITMFIVFQAVFAWANPFIEMLENLFSFIGEFLGSIITQPLLNSLVVDGIIGGVGSII
FT                   VYLPQILILFFFIFVLEESGYLPRASFLLDKLMVSAGLSGRAFIPLLSSFACAIPGIMA
FT                   TRTITDRTDRIATIMVAPLMTCSARLPVYALLIAAFIPNQTVAGIFNLQGVVLFGLYIA
FT                   GIVSALVVSLVMKLFRKNKENSLFLMELPAYRMPNWRSVFLGVYERAWIFIRRVGGIIF
FT                   ALTILLWFLCTFPTPPENATLPAIDYSFAGMLGHLLQPIFAPIGFNWQITIALIPGLAA
FT                   REVVVAALGTVYALSGSEDAQAETLVNLITADGTGWSLATGLSLLVWFIYAPNCLATLA
FT                   TIRRETGSMRTVTIMVVYMFALAYLMAFFTYQLASYYWG"
     atgacaaccg acctgagaat tgccttagtt ggtaatccaa attgtggtaa aacttcatta        60
     tttaaccatt taactggtac acgtcaaaaa gttgcaaatt atgctggtgt aacagttgag       120
     aaaaaagttg ggcattttac acttccctca tccaataaag tacgaatact tgatcttcct       180
     ggtacatata gtttatctgc aacaagccca gatgaagcaa ttactcgtga tgtttgcaac       240
     ggtcttacag aagaggcaca acaagatgct ttcatttgtg tcgtagatgc tacaaatcta       300
     aaacttcatt taggattagt tttagaagta ctggctctag gccgtcccgt attagttgtt       360
     ttaaacatga tggatgaagc tcgtcgtcga ggcattcaga ttaatatcga aaaattatct       420
     cagcatttgg gtgttcctgt ggttgaaaca gttgctgtca aaagctcagg tttaacccaa       480
     ttgatagatg ccctagataa ggaagtcttt cacacccctc atactgattt cactgccaag       540
     attgattccc cacaaaaaca tattgaatat gtcctagcaa ccacgattac agatcaaggt       600
     aaagttgata cccgaacaga gtttctagat aagattttac ttcatcctat tgctggactt       660
     cttattctag caatcactat gtttatcgta ttccaagccg tatttgcttg ggcaaatcca       720
     ttcattgaga tgcttgagaa tctatttagt tttattggtg aatttctcgg aagtatcatc       780
     acccaacccc ttttaaatag tcttgtcgtt gatggcatta tcggaggagt gggaagtatt       840
     attgtttatt taccccagat tctgattttg ttcttcttta tctttgtact agaagagtca       900
     ggctatcttc cccgtgcctc ctttttatta gataagctta tggtaagtgc aggtttaagt       960
     ggtcgagcat ttattcctct tctttccagt tttgcctgtg caatccctgg cattatggca      1020
     acaagaacta tcactgatcg taccgaccgt attgcgacga tcatggttgc tcccctcatg      1080
     acgtgctcag cacgactacc tgtttatgcc ttattgatcg cagcgttcat cccaaatcaa      1140
     actgttgcag gtatttttaa cttgcaggga gttgtactat ttggactcta tattgcagga      1200
     attgtcagtg cattggttgt gtcactggtg atgaaactgt ttagaaagaa taaggaaaat      1260
     agcttattcc taatggaact acctgcttat cgaatgccta actggcgtag tgttttcctt      1320
     ggggtttatg aacgtgcctg gatattcatc agacgtgtgg gcggaatcat ctttgcacta      1380
     accattcttc tttggtttct gtgtacattt ccaacacctc cagaaaacgc cacgttacca      1440
     gcgatagatt atagttttgc aggcatgctt ggacatcttc tacaaccaat attcgcacca      1500
     atcggtttca actggcaaat tactattgcg ctgatacctg gacttgctgc ccgtgaagtg      1560
     gttgttgctg ccctaggtac agtttatgcg ctctctggca gtgaagatgc tcaggcagaa      1620
     acactggtca acttgatcac agccgatggt acaggctggt cactagcgac aggcttatct      1680
     ttactggtgt ggtttatcta tgcacccaac tgtttggcaa ctttagccac catacgaaga      1740
     gaaactggct ctatgcgaac ggtgacaatt atggtggtct atatgtttgc ccttgcatac      1800
     ttaatggcct ttttcactta tcaactagct tcctattact ggggctaa                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page