(data stored in ACNUC29543 zone)

EMBL: CP000521.PE687

CP000521.PE687       Location/Qualifiers
FT   CDS_pept        778319..778627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0654"
FT                   /product="regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11103"
FT                   /protein_id="ABO11103.2"
FT                   /translation="MRLLVVAGAEGMASGQIAEALDGAAPSRISFHLSHLENAGLIYSR
FT                   REGRQIIYCAIWSTLADLVAFLMHDCCQGHCEYCDKAIELFAKCTGEPTEGYIKIGE"
     gtgcgtttac ttgtggtcgc tggtgctgaa ggcatggctt caggacaaat tgctgaggca        60
     ctagatggcg cagcaccatc aagaatttct tttcatttaa gtcatttgga aaatgcaggg       120
     ctgatctaca gtcgccgaga gggtcggcaa attatctatt gtgcaatttg gtctactcta       180
     gcagatctcg ttgcattcct gatgcatgac tgttgccaag ggcattgtga atattgcgac       240
     aaagcaattg agttgtttgc taaatgtaca ggtgaaccga ccgagggtta tatcaaaata       300
     ggagaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page