(data stored in ACNUC29543 zone)

EMBL: CP000521.PE688

CP000521.PE688       Location/Qualifiers
FT   CDS_pept        778665..779627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0655"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11104"
FT                   /protein_id="ABO11104.2"
FT                   /translation="MENLRSLLEDHQVKIYFITIFIGTIFGLTISGVSSLESAINPALA
FT                   LMLFATFLQVPIAEIGKAFKNLKFISALLITNFIALPAITAGLIQFLPENPLIRLAVLF
FT                   VLLAPCIDYVITFTHVGKGNARLLLAMTPILLLIQMILLPVYLGTLLGDEVSQLVEMEP
FT                   FLHAFIWFIIVPLTLAGIVQFISNKSESLATLSAPLNLLPVPATALVLFIVLASVTPQI
FT                   GLAQSAALQALPIYIAFAIIAPFIGWAIASLFKLESSSARAVSFSASYRNSLVILPLAL
FT                   VVPGSMPIIPAVILTQTIVELCFLPIYTRLIPRMFPSKD"
     atggaaaatc tacgcagctt acttgaagac catcaagtca agatctactt tattacgata        60
     tttattggaa ccatttttgg gctaactata agtggggtaa gtagtttaga aagtgcaatt       120
     aatccagcat tggcattaat gttatttgcc acttttttac aggtacccat tgctgaaata       180
     ggtaaagcat ttaagaacct aaaattcatt tctgctttat taattaccaa ctttattgcc       240
     ttacctgcta tcaccgcagg cctaatccag tttctacctg aaaatccatt gattcggctg       300
     gctgttttat ttgtactctt agctccttgc attgattatg tgattacctt tacacatgtg       360
     ggaaaaggta atgcgaggtt actgcttgca atgacaccaa tattattact tattcaaatg       420
     attctgcttc cagtctacct tggaacatta ttaggtgatg aggtatcaca gcttgtcgaa       480
     atggaaccat ttttacatgc tttcatttgg tttattattg tacccctgac acttgcaggc       540
     attgttcagt ttattagcaa taaaagtgaa tcattggcta cgctttccgc acctttaaat       600
     ttactgcctg tacccgctac agcacttgtt ctgtttattg tgcttgcatc agtgacgcct       660
     caaattggac tcgctcagag tgctgctctt caggctttac caatttacat cgcctttgcc       720
     attattgctc cctttatagg ctgggctatc gcatccttgt tcaaactgga gtctagttct       780
     gcaagagctg tatctttttc agcatcatat cgaaattctt tggttatcct accattagct       840
     ctagtagtac ctggaagtat gcctattatc cctgctgtaa ttctaacgca aacaattgtt       900
     gaactttgtt ttctaccaat ttatacacga ttgattccca gaatgtttcc atctaaagat       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page