(data stored in ACNUC29543 zone)

EMBL: CP000521.PE702

CP000521.PE702       Location/Qualifiers
FT   CDS_pept        792284..792508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11116"
FT                   /protein_id="ABO11116.2"
FT                   /translation="MTTQHIIEPGQAVHQAAAILSSLEYINQAEARSLGPLAEAVANAF
FT                   MVVYYQAETGRATQADFQEAMNALRQACS"
     atgacaacac aacatattat cgaaccaggg caagcagtgc atcaagcagc ggctattctt        60
     tcttctttgg agtacatcaa ccaagcggaa gcgcggagcc ttgggccatt ggccgaagcc       120
     gtcgctaatg cttttatggt ggtgtactac caagctgaaa cgggccgggc gacacaggct       180
     gattttcaag aagcaatgaa cgccttgcgc caagcgtgca gctaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page