(data stored in ACNUC29543 zone)

EMBL: CP000521.PE704

CP000521.PE704       Location/Qualifiers
FT   CDS_pept        complement(793984..794433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0671"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11119"
FT                   /protein_id="ABO11119.2"
FT                   /translation="MTERIYNVLILCTGNSARSIMAEALINTMGQGRFRAYSAGSHPTG
FT                   KVNPFAVEKVESVNYPTENLRSKSWDEYATPDAPKMDFIITVCDNAAGEMCPVWPGQPI
FT                   SAHWGFEDPAAVEGTDAEKRRGLRTNLPAHDEPRPPVRESASQNA"
     atgaccgaaa gaatctataa cgtcctcatc ctctgcaccg gcaattcggc gcgcagcatc        60
     atggccgaag ctctcatcaa cacgatgggg caagggcgct tccgcgccta cagcgccggc       120
     agtcacccaa ccggcaaggt caatcccttc gccgtcgaaa aggtggagtc ggtgaattac       180
     ccgaccgaga atctgcgcag caagagctgg gacgagtacg ccacgcccga cgcaccgaag       240
     atggacttca tcatcaccgt ctgcgacaac gccgccggcg aaatgtgtcc ggtgtggcct       300
     ggtcagccga tctcggcgca ttggggattt gaagacccgg ccgccgtcga aggcactgac       360
     gccgagaagc gccggggcct tcgaacaaac cttccggcac atgatgaacc gcgtccgcct       420
     gttcgtgaat ctgcctctca aaatgcttga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page