(data stored in ACNUC29543 zone)

EMBL: CP000521.PE714

CP000521.PE714       Location/Qualifiers
FT   CDS_pept        814760..815011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0684"
FT                   /product="putative toluene tolerance protein Ttg2F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11128"
FT                   /protein_id="ABO11128.1"
FT                   /translation="MNSEQLTQILKEAFPEAEVVVSGQAGKFDLRIVDDQFEGKRTVAR
FT                   QQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA"
     atgaatagtg aacagctcac tcaaatttta aaagaagctt ttcctgaggc ggaagtagtg        60
     gtgagcggac aggctggaaa atttgacctc cgtattgtgg atgatcaatt tgaaggtaag       120
     cgtactgttg cccgccaaca agcagtttat gcaccattaa atacttatat tgcaagtggc       180
     gaagttcatg ccgtaacaat tcgtgcgatg accaaagatg aatggcgcaa agcaagcctt       240
     ttcggagctt aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page