(data stored in ACNUC29543 zone)

EMBL: CP000521.PE72

CP000521.PE72        Location/Qualifiers
FT   CDS_pept        complement(78158..79528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10561"
FT                   /protein_id="ABO10561.2"
FT                   /translation="MTTLTCFKAYDIRGKLGTELNEEIAYKIGRAYGQIYKPKTVVVGC
FT                   DIRLSSEALKQATIRGLNDAGVNVLDLGMTGTEEVYFAAFHLDVQGGIEVTASHNPMDY
FT                   NGMKLVRENARPISADTGLKEIQALAETNNFEEVSQKGTTQSYNILPEFVDHLLTYIEP
FT                   AKIRPLKLVVNAGNGAAGHVIDAIEEKFKALNVPVEFIKIHHEADGTFPNGIPNPILIE
FT                   NRDSTRNAVLEHKADMGIAWDGDFDRCFLFDEKGQFIEGYYIVGLLAQAFLIKQSGEKI
FT                   VHDPRLVWNTFDIVDEYKGVAVQSKSGHAFIKDVMREHNAVYGGEMSAHHYFRDFAYCD
FT                   SGMIPWLLTIALLSETGQSLSTLVENMIAKFPCSGEINFKVADTQTTIQKIFDFYADQN
FT                   PQIDRTDGVSLDFGAWRFNVRASNTEPLLRLNIESRADRQAQPMQYYVDELTGLIQN"
     atgactactt taacgtgttt taaagcttat gatatccgag gcaaactcgg caccgaattg        60
     aatgaagaaa tcgcctataa aattggccgc gcttacggac aaatctataa accaaaaact       120
     gtggttgtag gttgtgatat tcgtctaagc agtgaggctt taaaacaagc gaccatccgc       180
     ggtttaaatg atgcgggtgt gaatgtgctt gatttaggca tgacgggtac tgaagaagtg       240
     tactttgccg cttttcattt agacgtacaa ggtggtatag aagtaactgc gagtcataac       300
     ccaatggact ataacggtat gaaattggtt cgagaaaatg ctcgtccaat tagtgccgat       360
     actggtttaa aagaaattca ggctttagca gagaccaata attttgaaga agttagccaa       420
     aaaggtacaa cgcaaagcta taacattttg cctgagttcg ttgaccatct actgacttat       480
     attgaacctg caaaaatccg tccattaaag ttagtggtaa acgcgggtaa tggtgcagct       540
     ggtcatgtga ttgatgccat tgaagaaaaa tttaaagcgc ttaatgtacc ggttgaattt       600
     attaaaattc atcatgaagc agatggtact ttcccaaatg gcatccctaa cccaatttta       660
     attgaaaacc gtgacagtac ccgaaatgct gttcttgagc ataaagcaga tatgggtatt       720
     gcatgggacg gcgactttga ccgctgtttc ttgttcgatg aaaaaggaca attcattgag       780
     ggctactata ttgttggcct attggctcaa gctttcttaa tcaaacagtc aggcgaaaaa       840
     attgtgcatg acccacgttt agtgtggaac acatttgata tcgtcgacga atataaaggt       900
     gttgctgtac agtcaaaatc ggggcatgca tttattaaag atgttatgcg tgaacacaat       960
     gccgtatacg gcggtgaaat gagtgcccac cactatttcc gtgattttgc ttactgtgac      1020
     agtggtatga ttccttggtt actcaccatt gctctactct ctgaaacagg acaatctctc      1080
     tcaacactcg ttgaaaatat gattgccaag ttcccttgta gtggtgaaat caactttaaa      1140
     gtagccgata cgcaaactac gattcaaaag attttcgact tctatgccga tcaaaatcca      1200
     caaattgacc gtaccgatgg tgtaagcctc gactttggcg catggcgctt taacgtccgt      1260
     gcttcaaata ctgagccttt gttacgtctt aatattgaaa gccgtgcaga tcgtcaagct      1320
     cagccaatgc aatattatgt agatgagttg actggattaa ttcagaacta a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page