(data stored in ACNUC29543 zone)

EMBL: CP000521.PE732

CP000521.PE732       Location/Qualifiers
FT   CDS_pept        834129..834356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0702"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11146"
FT                   /protein_id="ABO11146.1"
FT                   /translation="MKDSFNAAKQTVTKWEVAQGIEPSEPQWMIGKNMELMLPQLEKYL
FT                   FPQPNTGSVNIAQTQTEAKNDATPAKKPLL"
     atgaaagatt catttaatgc tgctaagcaa accgtaacca aatgggaagt agctcaaggt        60
     atagaacctt cagagccaca atggatgatt ggtaagaata tggaacttat gctacctcag       120
     ttggaaaaat atctttttcc tcaaccaaat acaggtagtg taaatattgc tcagacacaa       180
     acagaggcta aaaacgatgc aactcctgca aaaaaaccgc tgctttga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page