(data stored in ACNUC29543 zone)

EMBL: CP000521.PE734

CP000521.PE734       Location/Qualifiers
FT   CDS_pept        complement(835173..835445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11148"
FT                   /protein_id="ABO11148.2"
FT                   /translation="MKSTTHLLTNDGKRIAKRLVNHWKHKFEVQETEQDFKILMPTATI
FT                   TLAPETEQLNVAIDSQLDDHNHLEKVVLDHLNRMAQQEFQVEWQH"
     atgaaaagca caactcatct attaacaaat gatggaaaac gcattgcaaa acgtctagtt        60
     aatcattgga aacataagtt tgaagtacaa gaaactgaac aagattttaa aatcttaatg       120
     cctaccgcaa ccattacgct tgcaccagaa acagagcagt taaatgttgc tattgatagt       180
     cagttagatg accacaacca cttagaaaaa gttgttcttg atcatctaaa ccgcatggct       240
     caacaagaat ttcaggtgga atggcagcac taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page