(data stored in ACNUC29543 zone)

EMBL: CP000521.PE740

CP000521.PE740       Location/Qualifiers
FT   CDS_pept        840736..841731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0709"
FT                   /product="putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11153"
FT                   /protein_id="ABO11153.2"
FT                   /translation="MPLVYTDGIVFCVSYGAKMALEKQENQINVNKSCSGCGCSNVAAQ
FT                   DFSVASEPRVNKTQWVSYYHIPRMDCAAEEQMVRMALASYAEHIQELYFDLPARHLAVY
FT                   HSTQDEKITQCLQRLGLGAELQQTQPHYEPVEKPKKVRPSSSTNAAQKQVLQWLLLING
FT                   VMFVIELMAGIIASSTGLIADSLDMFADAAIYGIALFVVGKNLDAQLKAAHLSGWFQFG
FT                   LAIIVLIDVLRRFIYGSEPVSILMILIGGLALAANISCLYLMSDHKESGAHMKASYIFS
FT                   ANDVIVNLGVIVAGILVAMTGSRYPDLIIGLIIVLFVLNGARKILQLKNE"
     atgccattgg tttatactga tggcattgtt ttttgtgtca gttatggtgc aaagatggct        60
     ttagaaaaac aagagaatca aataaatgta aataaaagct gttctggctg tgggtgctca       120
     aatgtagcag ctcaggactt ttctgtggca agtgaaccta gggtaaataa aacccaatgg       180
     gtgagttatt atcatattcc ccgtatggat tgtgcagccg aagaacaaat ggtaagaatg       240
     gctttagctt cttatgctga gcatattcaa gaactttatt ttgatttgcc cgcccgccac       300
     ttagcggtgt atcacagtac tcaagatgaa aagattacgc agtgcctgca acgtctaggt       360
     ttaggagccg aattacaaca aactcaacca cattatgagc ctgttgaaaa acccaaaaag       420
     gttcgaccaa gttcctcaac taatgcagca caaaaacagg tcctacaatg gctgttactg       480
     attaatgggg tcatgtttgt cattgagtta atggcaggca tcattgcctc ctccacaggg       540
     ttaattgctg actcgctcga tatgtttgcc gatgctgcaa tttatggcat tgcattattt       600
     gtggtaggta aaaaccttga cgctcaatta aaggctgcac atctttccgg atggtttcag       660
     tttggtttag ccataatcgt tttaattgat gtgctgcgcc gttttatata tggcagtgaa       720
     ccagtttcaa ttttaatgat tttaattggg ggattagcgc ttgcggccaa cattagttgt       780
     ctttatttaa tgagcgacca taaagagagc ggggcacata tgaaggcgag ttatatattt       840
     tctgcaaatg atgtcatcgt aaacttaggt gtcattgttg cgggaatatt ggttgccatg       900
     acaggctcgc gttatcctga tttaattatt ggattgatta ttgttttgtt cgttttaaat       960
     ggtgcacgaa aaattttaca gttaaaaaat gaataa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page