(data stored in ACNUC29543 zone)

EMBL: CP000521.PE743

CP000521.PE743       Location/Qualifiers
FT   CDS_pept        842829..844049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11156"
FT                   /protein_id="ABO11156.2"
FT                   /translation="MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNV
FT                   AGVFTQNAFCAAPVHVSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELA
FT                   GVNSFEVLPFSTGVIGEQLPMERLLAGLQPALNSVQDSAWSDAASGIMTTDTVPKGASE
FT                   QFELDGITYTMTGISKGAGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRIT
FT                   IDGDTSTNDSCIFVATGQAGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATK
FT                   FITVAVEGGANTQECCDIAYSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKI
FT                   QVWLDDVQICKDGGAAEDYTEEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVK
FT                   INADYRS"
     atggctgtcg gtgacgtaac aatgccacaa atgcatgtgg taaaaggtgt aaaaattggc        60
     tcaacagaag catatgtacg ttacccaaac cgacgagatc tagtcatttt tgaatttgca       120
     gaaggttcaa atgttgcagg tgtatttacg caaaatgcat tctgtgcggc acctgttcat       180
     gtctctaaag cccatcttgc cgaaggtaat ccgcgctatt tagtgattaa tacaggtaat       240
     gccaatgctg gtactggtcc tacaggtttg aaaaatgctc aggatacttg tgcaaagtta       300
     gcggagcttg ctggtgttaa cagtttcgaa gtacttccat tttctacagg tgtgattggt       360
     gagcagcttc cgatggaacg tttactcgct ggcttacaac ctgcattaaa tagcgtacaa       420
     gactctgcat ggagtgatgc ggcatctggc attatgacaa cagacacagt gcctaaaggc       480
     gcatctgaac aatttgagct tgatggcatt acttatacca tgacaggtat tagtaaaggc       540
     gctggaatga ttcgcccgaa catggcaacc atgctgagct ttgtggcaac agatgcgcct       600
     attcgccgtg atttagtaca aaagctatta aagactacag ttgagcattc atttaaccgt       660
     attaccattg atggtgatac ctcaacaaat gactcttgta tttttgtagc aactggtcag       720
     gctggtggtg ctgaaattac atcggaaagc gatgtacgct acgctaaagt gttagaagta       780
     cttgctcgtg taatgaaccg tttagcacag ttaattgtcc gtgatggaga aggtgcaacc       840
     aagtttatta ctgttgctgt tgaaggcggt gcaaatactc aagaatgttg tgacattgct       900
     tatagcattg cgcattcacc acttgttaaa actgcacttt ttgcatcgga tccgaactgg       960
     ggacgcattt tagctgcaat cggctatgct ggagtgaaag acttagacgt gtctaaaatt      1020
     caggtatggt tagacgacgt gcaaatctgt aaagatggtg gcgcagccga ggactatacc      1080
     gaggaagcag gtgctcgtgt aatggcacaa accgaaatta ccattcgtgt tgacttaggc      1140
     cgtggacaag ccaaagacac ggtatatacg tgtgacttat cttacgacta tgtcaagatt      1200
     aatgcagatt accgttcgta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page