(data stored in ACNUC29543 zone)

EMBL: CP000521.PE752

CP000521.PE752       Location/Qualifiers
FT   CDS_pept        complement(855091..856497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11165"
FT                   /protein_id="ABO11165.2"
FT                   /translation="MHDVIVIGGGNAALCAALTARESGASVLVIEAAPKEWRGGNSQHT
FT                   RNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTAGKTNEHLARLVIRSTATCRDWMRKHGV
FT                   NFQPPLSGALHVARTNAFFMGGGKALINAYYRSAEKLGIEILYNTKIKDLKLNQGHFEA
FT                   AIAEDGRVFKAKSCVLAAGGFESNLEWLREAWGQNENGEWPADNFIIRGTRFNQGNLLK
FT                   FMIDQGADIIGDPSQSHCVAVDARAPLYDGGICTRIDCVSLGIVVNNKAERFYDEGEDF
FT                   WPKRYAIWGRLVAKQPQQIAYSIIDSKAIGRFMPPVFAGVKANSIQELAEKIGLDAKTL
FT                   CHTVEEFNQACVQGTFNHTVLDDCTTENIIPNKTHWAVPLDQPPFYAYALKPGITFTYL
FT                   GLKVEDDAAVRFNNKASRNLFVAGEMMAGNVLGQGYTAGVGMSIGTTFGRIAGKNAAHY
FT                   ALSQGVEHEC"
     atgcatgatg taattgtgat tggtggtggg aatgccgcac tgtgtgccgc gctcacggca        60
     agagaaagtg gtgcttctgt gctggtaata gaagcagcgc ccaaagagtg gcgtggtggt       120
     aactcccaac acactcgtaa ccttcgctgc atgcatgatg ctcctcaaga cgtattggtc       180
     gatgcttatc ccgaagaaga atattggcaa gacctactta aagtcactgc gggcaaaacc       240
     aatgaacatt tagctcgtct agtgattcgt agcacggcga cttgccgcga ctggatgcgt       300
     aaacatggcg tgaattttca gccaccacta tcgggtgctt tgcatgttgc acgtaccaat       360
     gcctttttta tgggtggagg taaagccctt attaatgcct actaccgtag tgctgaaaaa       420
     cttggcattg agattttata caatacaaaa attaaagacc taaagttaaa ccaaggacat       480
     tttgaagctg caattgcgga agatggacgt gtatttaaag caaaaagctg tgtattggcc       540
     gcaggtggtt ttgaatcaaa tttagaatgg ttaagagaag catggggaca aaatgaaaac       600
     ggcgaatggc ctgccgataa ttttattatt cgaggtaccc gctttaatca aggcaactta       660
     ctcaaattta tgatagatca aggcgccgat attattggtg acccatcaca atcacattgc       720
     gtcgctgtag atgcacgcgc accattatat gacggcggca tctgcacccg tattgactgc       780
     gtttctttgg gaattgtggt caataacaaa gccgaacgtt tttatgatga aggtgaagac       840
     ttctggccaa aacgttatgc gatttggggc cgtcttgttg ccaaacagcc acagcaaatt       900
     gcctattcga ttatcgattc aaaagccatt ggtcgcttta tgccccctgt gtttgcgggt       960
     gtaaaagcaa atagcattca agagttagcc gaaaaaatcg gactggatgc aaaaacctta      1020
     tgccataccg tagaagaatt taatcaagcc tgtgtgcaag gcacctttaa ccataccgtt      1080
     ttagatgact gcaccaccga aaatattatt cccaacaaaa cccattgggc cgttcctctc      1140
     gaccagccac ctttctatgc ctatgccctt aaacccggca ttacctttac ctatttaggt      1200
     ttaaaagtcg aagacgatgc tgcggtacgc tttaacaata aagccagccg caatctgttc      1260
     gtcgcaggtg aaatgatggc aggtaatgta ctcggtcagg gttataccgc aggtgtcggc      1320
     atgtcgatcg gcacaacctt tgggagaatt gccggaaaaa atgccgccca ctatgcactt      1380
     tcacaaggag ttgaacatga atgctag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page