(data stored in ACNUC29543 zone)

EMBL: CP000521.PE754

CP000521.PE754       Location/Qualifiers
FT   CDS_pept        complement(857662..858456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0727"
FT                   /product="putative substrate-binding protein"
FT                   /note="ABC superfamily peri-bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11167"
FT                   /protein_id="ABO11167.2"
FT                   /translation="MKKSPIFITICLAGAGLGSTFANADTLEVISSGGFYSSMEKLIPI
FT                   FEKQTGHTVHLSSGSSMGESPTAIPNRLNRGERFDIVVLAGPELSKLAEKGYVDPNSQS
FT                   ALVNSSIGMAVPKGAPKPDISSAAKFEKVLLNAKHIGYSASASGTHLEKDVFPSFPPVE
FT                   YKVISSKAEKVVGDRVAKRIAEGQFDIGFQQISEIKPFTGKYGQVELVGPIPAPYQKVT
FT                   VFAAGIGKNSEHAKVAKELIKFVKSPQATQIIEEQGLEQVKQ"
     atgaaaaagt cccctatctt tataaccatt tgcctagctg gtgcaggctt aggatctaca        60
     tttgccaatg cagatacgct cgaagtaatt agctcaggcg gtttctattc atctatggaa       120
     aaactcattc caatatttga aaagcaaact ggtcacacgg ttcacctctc atctggttcg       180
     tctatgggtg aatcaccgac tgcaattcca aatcgactca atcgtggtga acgttttgac       240
     attgttgtgt tggctggtcc tgaactaagc aaactcgcag aaaaaggtta tgttgaccca       300
     aattcacaaa gcgctttagt gaattcaagc attggcatgg ctgtgcctaa aggtgcacca       360
     aagccagaca ttagctctgc ggcgaaattt gaaaaagttt tattaaatgc caagcacata       420
     ggctattcag caagtgcgag tggtacgcat cttgaaaaag atgttttccc aagctttcca       480
     cctgtcgaat acaaagtaat ttcgagtaaa gcagaaaaag tggtaggcga ccgcgttgca       540
     aaacgtattg ccgaaggcca gtttgatatt ggtttccagc aaattagtga aatcaaacct       600
     tttaccggca aatatggtca agttgagtta gttggtccaa tccctgcgcc ttaccaaaaa       660
     gttaccgtat ttgctgctgg tattggtaaa aactcggaac atgcaaaagt cgcaaaagag       720
     ttaattaaat ttgtgaaatc gcctcaagcg acacaaatta ttgaagaaca gggtcttgag       780
     caggttaaac aataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page