(data stored in ACNUC29543 zone)

EMBL: CP000521.PE757

CP000521.PE757       Location/Qualifiers
FT   CDS_pept        861368..862753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0730"
FT                   /product="putative long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11170"
FT                   /protein_id="ABO11170.2"
FT                   /translation="MNFVVNKKIFILGIASICTSTLHAAAFDKTGQSVAAFLQPGNYFE
FT                   ASLGITDADLSGVESGTNPSHHSILDIANTDYRPTAALKLQLAPQYSFGLLYDQPFGAD
FT                   TEYSGVNGFVATPKDTVMLPGITTTGLASATLGHAPTGNAKSEFDIQNLSFILGYQPTK
FT                   NWNLYAGPVYQTFKSQVELRGNVFSLYNGYDFHTKTVSDLGWLAGLAYQIPEKAVKVSL
FT                   TYRSAITHKVNATENAPLIDMLSTQQGRDLVNQHLDFMISIGQMTPQKKAYLNQIIANL
FT                   PEQEDTGTTKFKSPDSVNLEFQTGLRQGTLLFGSLRWVNWSDLALQPYRFGEISKVVGV
FT                   LSTPSRPEGFNLVRYYDDQWSLNLGLGQRFSPKWLGSVSVGWDSGAGDKVSTGGPTKGY
FT                   YNLGVGAQYSPTSRYFISGGVKYYWLGDAKAQLGAQAGSDYYVGEFKDNHSVSYGLKIG
FT                   YKF"
     atgaattttg ttgtgaataa aaaaatattt atcttaggaa tagcatcgat ttgcacaagc        60
     acattacatg ctgctgcatt tgataaaaca gggcagtctg tagcggcatt tttacaaccg       120
     ggcaactatt ttgaagcaag tttaggaata acagatgccg atttaagtgg tgtagagtcg       180
     ggtaccaacc cttcacatca ttcaatttta gatatcgcca ataccgatta tcggcctacg       240
     gcagcgttaa aactacagtt ggcaccgcag tattcatttg gtctgttata tgatcagcct       300
     tttggtgctg acacggaata ttcaggtgta aatggcttcg ttgcaacgcc aaaagatacc       360
     gttatgttac ctggaattac gaccacaggg cttgccagcg ctacattggg ccatgctcct       420
     acaggaaatg caaaatcaga atttgatata caaaatttaa gcttcatttt gggttaccaa       480
     cccacaaaaa actggaatct ttatgcgggg ccagtctatc aaacttttaa aagtcaggtt       540
     gaattaaggg gtaatgtatt tagtctctat aatggatatg actttcatac taaaactgtc       600
     agtgatttag ggtggttagc aggacttgct taccaaattc cagaaaaagc tgtgaaagtc       660
     tcattaacct accgttcagc cattacccat aaagtaaacg cgactgaaaa cgctccttta       720
     attgatatgt taagcactca acaaggtcgt gatttagtta atcagcatct agatttcatg       780
     atttctattg gtcagatgac tccacaaaag aaagcttact taaatcagat tattgctaat       840
     ttgccagaac aagaagatac aggtacaaca aaatttaaat ctcctgattc agtgaatttg       900
     gagttccaga ctggactgcg tcagggaacg ttactatttg gtagtttacg ctgggtaaat       960
     tggagtgatc ttgctttgca accttatcgc ttcggtgaga tctcaaaagt tgttggcgta      1020
     ctatcaacgc caagccgtcc cgaaggtttt aatttggttc gttattatga cgaccaatgg      1080
     tctttaaatt tgggtttagg acaacgcttt tcgccaaaat ggttaggttc tgtgtcagtt      1140
     ggatgggact ctggagcagg agataaagtg tcaacgggtg gcccaactaa agggtattac      1200
     aacttgggcg tgggtgctca atatagcccg acatcgcgat actttatttc tggtggtgtg      1260
     aagtattact ggttaggcga tgcaaaagct cagcttggcg cacaggcggg tagtgactat      1320
     tatgtaggtg agtttaagga taaccactca gtcagctatg gcttaaaaat tggatataaa      1380
     ttttaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page