(data stored in ACNUC29543 zone)

EMBL: CP000521.PE760

CP000521.PE760       Location/Qualifiers
FT   CDS_pept        865406..866461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0733"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11173"
FT                   /protein_id="ABO11173.2"
FT                   /translation="MTYIYKNPAGMTDSEKTEHIKKIVTAEGVALRKRYPILNHQNAIG
FT                   AVILFFSLAGMITTAVLYINHQLSAWFAIPIIAFFASLTHELEHDLIHWMYFRKKPWAH
FT                   HLMMGLVWLARPSTINPWKRRELHFNHHKNSGTEVDLEERALTNGEQWSIRRLIAIGDN
FT                   GLAVLFRIISASNWTVRKVIFKRAFMAYFPLGIIHWSLWYIFLGFHAVDAVLSWANAPI
FT                   AWSATTLNIMHVVNILTVVWVAPNVLRTFCLHFVTSNMHYYGDVELGNVIQQTQVLKPW
FT                   WMMPFQLFCFNFGSTHAIHHFVVKEPFYIRQMTAPVAHKVMRDMGVRFNDVGTFKRANR
FT                   WNINDLSESKS"
     atgacctata tttataaaaa tcctgccgga atgaccgata gcgaaaaaac cgaacatatt        60
     aaaaagatag tgactgctga gggcgttgcg ctgcgtaagc gttatccgat tttaaatcac       120
     caaaatgcta tcggggctgt cattctattt ttttctttag caggaatgat cacgactgcg       180
     gtcctttata tcaatcatca actttcagct tggtttgcaa ttccaattat tgcttttttt       240
     gcatctctta cccatgagtt agagcatgac ctgattcact ggatgtattt tagaaagaaa       300
     ccatgggcac atcatttaat gatgggctta gtctggttag ctcgaccaag taccattaac       360
     ccgtggaagc gtcgtgagct gcattttaac catcataaaa actcaggcac cgaagttgat       420
     ttagaagaaa gagctttaac taatggagag cagtggagca tacgtcgact catcgcgatt       480
     ggtgataacg gcttggcggt cttgttccgt attatttctg caagcaattg gacggttaga       540
     aaagtaattt ttaaacgtgc atttatggct tattttccgt taggaattat tcattggtcg       600
     ctgtggtata tctttttagg ttttcatgca gtagatgctg ttttaagttg ggcgaatgca       660
     ccgattgctt ggtcagctac cactttaaat attatgcatg tggttaatat tttgactgtt       720
     gtttgggttg caccgaatgt actgcgtacc ttctgcttgc actttgtgac tagcaatatg       780
     cattactacg gcgatgtcga attgggtaat gtcattcagc aaactcaggt gttaaaacct       840
     tggtggatga tgccgttcca actgttttgc tttaactttg gttcaacgca tgccatccac       900
     cattttgtgg tgaaagaacc attctacatt cgccaaatga cggcaccggt tgcccataaa       960
     gtcatgcgtg atatgggagt acggtttaac gatgttggaa cctttaaaag agcaaatcgt      1020
     tggaacataa atgatttatc agagtcaaaa agttaa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page