(data stored in ACNUC29543 zone)

EMBL: CP000521.PE769

CP000521.PE769       Location/Qualifiers
FT   CDS_pept        875353..878292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0742"
FT                   /product="iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11182"
FT                   /protein_id="ABO11182.2"
FT                   /translation="MGSSLIIQANELYSTVNDLNSAISQGDGKGIDQQIAQLSLISTGL
FT                   GFTIEFAKIAKSPEAVAGLTGLKYQVDATLTGAALTQAMINIDQGNYSGAIANTLAAMS
FT                   TATGLVALAVDKPGLSTALNGLSGFLGASSNVAEKGPQIADALANALSEIQKMQHDGTF
FT                   PELDPGLMAGFAGEVLEGWSKEFYSWFPDDWNPWKNIDRNSDGVKKYHIYDPVVLDLDG
FT                   DGIETIAANKWAGVLFDHDNDGIRTSTGWVGSDDGILVLDRNGDGVINDGSELFGDSVT
FT                   LKDGSQASNGYAALAEFDSNGDGKVNAEDTNFEQLKVWRDLNQDGVSQTNELFGLTELG
FT                   IQSLNLNHTNTDTALGNDNILAQTGSFETLDGQSHIMGDVNFSFNSIYSSFNNAIELTA
FT                   EQQQAANLQGAGRVRDLREAAALSPELAETLKNYSNAETKAEQYDLLDQLILNWAKTDP
FT                   DFKEANEVRMVSWVKTANEGIALTPGQAAIVTLAAPLSKESQAMLDKIHHILPILDAFS
FT                   GSKPSQIYYENEADIKNVFNIINNAYVSLKEGIYTGLLYQTRLDDYLAEIELNLQATDP
FT                   TELFNYSGIQEKLEQIFIINPEKAFTDLSDLVNYHPDILTNWLPEGKTLLIQFLNEVIE
FT                   QGLWDDLASKVDLKILEQSGFIIGTKLDDTLNGTKNNDTLNGGWGNDKLNGGAGQDTLI
FT                   GGSGNAVMTGGDYEKDIYIFQSGHGQDIINDKSYDWTNLQYFNDVKFEGANFTDAQFLR
FT                   VGNDLVIKAFGTDDSVSFKNYLNDNDSYSRDFNFIFADKTLTTADVMNIVIPLNGTDGN
FT                   DVQNGWKGKDNLLGSLGDDTLNGLAGDDWLEGGAGNDILNGGEGNDLLEGGAGNDTLTG
FT                   GIGADTAIFKILAGFGNDATGGNGVDTWSDFNISQGDKINISELIIGPASKENLNQFVS
FT                   FEKSGSTVTLSLDRDGNDINYSATKLLILNNQTNVNSLNDLIKADVFIV"
     atgggttctt ctttaattat acaggcaaat gaactatata gtactgttaa tgatttaaat        60
     tcagctattt cacagggaga tggtaaaggt attgaccagc aaatagctca gctttcatta       120
     atttcaacag gcttaggttt tacgatcgaa tttgcaaaga ttgcaaaaag tcctgaagca       180
     gtagcaggtt taactggttt aaaatatcaa gttgatgcga ccttaactgg tgcagccttg       240
     actcaggcta tgatcaatat agatcaagga aattattctg gagcaattgc aaatactctg       300
     gcagcaatgt ctacagcaac tggccttgta gctctcgctg tagataaacc tggtttaagt       360
     actgcattga atggtctttc aggatttctt ggtgcaagtt ctaatgttgc agaaaaaggg       420
     ccacaaatag cagatgcttt agctaatgct ctttcagaaa tacagaaaat gcaacacgat       480
     ggaacattcc ccgaactaga tcctggttta atggctggat ttgctggcga agtattagaa       540
     gggtggtcaa aagagttcta tagttggttc ccagatgatt ggaatccttg gaaaaatatc       600
     gatcgaaaca gcgatggtgt aaagaagtat catatttatg atccagttgt cttagatcta       660
     gatggggatg gtattgaaac gattgctgcc aataaatggg ctggtgtgtt attcgatcat       720
     gataatgatg gtatccgtac atcaacaggt tgggttggtt cggatgacgg tatcctagta       780
     ttggatcgca atggtgatgg tgtcattaat gatggtagtg agttatttgg tgacagtgta       840
     actttgaagg atggtagtca agcaagtaat ggttatgctg ctctagctga gtttgacagt       900
     aatggcgatg gtaaagtaaa tgctgaagat acaaactttg agcagcttaa agtttggcgt       960
     gacctaaacc aagatggagt tagtcagacg aatgaattat ttggtttaac tgagttaggc      1020
     attcaatctt taaatttaaa tcatacaaat actgatactg cgttgggtaa tgacaacatc      1080
     ttggctcaaa ctggaagctt tgaaactcta gatggtcaaa gccatataat gggagacgtc      1140
     aattttagtt ttaatagtat ctacagcagt tttaataacg ctatcgaact aacagcagaa      1200
     caacaacaag ctgctaatct acaaggtgct ggacgtgttc gtgatcttag agaagctgcc      1260
     gctttatctc cagagctagc agaaacatta aaaaattatt caaatgcaga aactaaggct      1320
     gagcagtacg atttattaga ccaattgatt ttaaattggg caaaaactga tccagatttt      1380
     aaagaagcaa atgaagtgcg aatggtatct tgggttaaaa ctgctaatga aggtatcgca      1440
     ttaacaccag gacaagcggc aatagttact ttagcagcac cattgtcaaa agaatcacag      1500
     gcaatgttgg ataaaattca tcatatactt ccaatattag atgcattttc tggttcaaaa      1560
     ccttcacaga tttattatga aaatgaagca gatattaaaa atgtttttaa tattataaat      1620
     aatgcatatg tgagtttgaa agaaggtatt tatacgggct tgctttatca aactcgctta      1680
     gatgattatc tggcagaaat tgaactcaat ttacaagcaa cagatccaac tgagttattt      1740
     aattattctg ggattcagga aaaattagag caaattttta taattaaccc agagaaagca      1800
     tttaccgatt taagtgattt agtaaattat catcctgata ttttaaccaa ttggttacca      1860
     gaaggaaaaa cattattaat tcaattctta aatgaagtaa ttgaacaagg gttatgggac      1920
     gatttagcat ctaaagttga tctaaaaata ttagaacaat caggttttat tatcggaaca      1980
     aaattagatg atactttaaa tggtactaaa aataatgaca cattgaatgg tggttggggc      2040
     aatgacaagt tgaatggcgg tgctggtcag gataccttga ttggtggcag tggtaatgct      2100
     gtcatgacag gtggtgatta cgagaaagat atttatatct tccagtcagg tcatggacag      2160
     gacattatta atgacaaaag ctatgactgg accaatttac agtactttaa tgatgtgaaa      2220
     tttgaaggtg ccaactttac cgatgcccag ttcctgagag taggcaatga tctggtgatc      2280
     aaggcatttg gtacagatga ctcggttagc tttaagaact acttgaatga caatgattcg      2340
     tacagtcggg acttcaactt tatctttgcc gacaagacct taactacagc agatgtaatg      2400
     aatattgtca taccgcttaa cggtacggat ggtaacgatg tgcagaatgg ctggaaaggt      2460
     aaggacaatc tgttgggcag tcttggagat gacaccttaa atggcttagc tggagacgac      2520
     tggctggaag gtggagctgg caatgatatc ctgaacggtg gtgaaggtaa cgatcttctt      2580
     gaaggcggag cgggcaatga cacgctaact ggcggaattg gtgctgatac tgcaattttc      2640
     aaaattttag caggttttgg aaatgacgct acgggcggta atggcgttga tacatggtca      2700
     gactttaata tttcccaagg agataaaatc aatatctctg agttaattat tgggccagct      2760
     agtaaagaaa atctcaatca gtttgtatca tttgaaaaaa gcggttcaac agttacgcta      2820
     agtttagata gagatggaaa tgatataaat tattcagcca ctaagctatt aattttaaat      2880
     aatcaaacaa atgtaaatag tttgaatgat ttaattaaag ctgatgtatt tatagtttag      2940
//

If you have problems or comments...

PBIL Back to PBIL home page