(data stored in ACNUC29543 zone)

EMBL: CP000521.PE774

CP000521.PE774       Location/Qualifiers
FT   CDS_pept        complement(883242..884525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0746"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11186"
FT                   /protein_id="ABO11186.2"
FT                   /translation="MSILSWDDFEDDSQKPAAPEHKSAPVNPEKTPDSQNVSAAQPSSQ
FT                   SVAAPQSAGTHSVRSTNPTDSMARASEALEHLDVAPGLEELEMGAQRVQVDDKAMINCR
FT                   ADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDIALWKSENGLTEDERTIVMRSLG
FT                   FFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEVF
FT                   NMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRLLRNLIAFYCVLEGIFFYCGF
FT                   TQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQM
FT                   ILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWM
FT                   SEMMDLRKEKNFFETRVTDYQTGGALSW"
     atgtctatcc ttagttggga cgattttgaa gatgattcgc aaaaaccggc tgcacctgaa        60
     cacaagtctg cgcccgtcaa cccggaaaaa acgcctgatt cgcagaatgt atctgctgcg       120
     cagccatcat cgcagagcgt ggcagctcca caatccgctg gaacccattc cgtgcgatca       180
     acaaatccaa ccgattcaat ggctcgagca tctgaagcct tagaacattt ggatgttgct       240
     cctggccttg aagagttaga aatgggcgcg caacgcgttc aggttgacga caaagccatg       300
     attaactgtc gcgctgactt gaaccagctt gttccattta aatatgagtg ggcttggcaa       360
     aaatatctag atggttgtgc aaaccactgg atgcctcaag aagtgaacat gaaccacgat       420
     atcgcacttt ggaagtctga aaatggctta actgaagatg agcgtacgat cgttatgcgt       480
     tctttaggtt tcttctcgac tgcggactct ttggttgcaa acaacctcgt attggcaatt       540
     taccgccaca tcacgaaccc tgaatgccgt cagtacattt tacgtcaagc gtttgaagaa       600
     gcaattcaca ctcatgctta ccaatactgt atcgaatctt taggtatgga cgaaggcgaa       660
     gtcttcaaca tgtaccgcga gattccatcg gttgcgcgta aagcagcttg gggcttgaag       720
     tacactcaat cgttaagtga ccctactttc cacacaggta cgcctgaaaa cgaccaacgt       780
     ttacttcgta acttgatcgc gttctactgt gttcttgaag ggatcttctt ctactgtggc       840
     tttactcaaa ttttgagtat gggtcgccgt aacaagatga atggtgttgc tgagcagttc       900
     caatacattt tgcgtgatga gtctatgcac ttgaactttg gtatcgacat gattaaccaa       960
     atcaagattg agaaccctca cctttggact gccgagttcc aacaagaagt aattcaaatg      1020
     attcttgaag gtacgatgct tgaaatcgaa tacgcacgtg acacaatgcc acgcggtgta      1080
     ttgggtatga acgcaagcat gatggaagaa tatttgaaat tcatctgtaa ccgtcgttta      1140
     tctcagttag gtttaccaga gcaatttgct ggtgtaacta acccatttgc gtggatgtcg      1200
     gagatgatgg acttacgtaa agagaagaac ttctttgaaa ctcgcgtaac tgactaccaa      1260
     actggtggtg cgttaagctg gtaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page