(data stored in ACNUC29543 zone)

EMBL: CP000521.PE795

CP000521.PE795       Location/Qualifiers
FT   CDS_pept        908836..909129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0766"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11206"
FT                   /protein_id="ABO11206.1"
FT                   /translation="MKQEFYTGRVKQYNADKGFGFISTTEGDIFFHISDFPASEGEPKR
FT                   NEKVRFLAADNRGKFKAVKIERIDPNPAKTKKTKIADHNKAITSELLSNFRR"
     atgaagcaag agttttatac tggaagggta aaacaatata acgccgataa aggatttggt        60
     tttatttcga cgactgaagg agatattttc tttcatattt ctgatttccc tgcatccgaa       120
     ggtgaaccga aaagaaatga aaaagtgaga tttcttgctg cagataatcg aggaaaattt       180
     aaagctgtta agattgagcg tattgatcct aatcctgcga agactaagaa aactaaaatt       240
     gctgatcaca ataaagcgat cacaagtgag ttattgtcaa atttccgacg ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page