(data stored in ACNUC29543 zone)

EMBL: CP000521.PE802

CP000521.PE802       Location/Qualifiers
FT   CDS_pept        914512..914682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3565"
FT                   /old_locus_tag="AS1_3565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89990"
FT                   /protein_id="ABS89990.1"
FT                   /translation="MKKPGRFLAPVVIAGITVGFLASAYKFVFSKSESSKQTTSHKHDS
FT                   EKSSNDSKASN"
     atgaaaaaac ctggtcgttt tttagcacct gttgtaattg ctgggattac cgttggtttt        60
     ttagcaagtg cttataaatt tgtatttagc aaatctgaat catcaaaaca gacaacaagc       120
     cataagcatg attctgaaaa atcatccaat gattcaaaag catcaaatta g                171
//

If you have problems or comments...

PBIL Back to PBIL home page