(data stored in ACNUC29543 zone)

EMBL: CP000521.PE81

CP000521.PE81        Location/Qualifiers
FT   CDS_pept        92999..95467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10570"
FT                   /protein_id="ABO10570.1"
FT                   /translation="MEKNDTFLSDLLTTYKKLKLSDANEAETRKKLIDVVIENVLGWTT
FT                   DDISYEERVSEDGETTYADYIIRTADVSILIEAKRLGSTFYTVPEKKKVKLSTFSEDDL
FT                   TGKAIKQAREYCRKKSIPFAAVTNGSQWIIFPAVRTDSVSFSDSTALVFDSIERILGEE
FT                   SSHFRGLLSRDGVIEGNLALELIGRKTDQFDERRLNKFFKGISIKKENPIYPLIEGAVV
FT                   SAFSDSIVDNDNSILEKCYVKNADRKKFDNRIEMHLQKREPLFNSQPKRPMRKRESSSL
FT                   VDSINKASHNKKPLAILILGTVGTGKTTFLQYTRRISSASFFEQKEKQPYPHWIEIDFR
FT                   TFSKNENPLDFIYDKLFDYIKTDKFFCDYDRSIKFAYEKEINSLKSGPLFLLANSDEEL
FT                   KKRITDLLIADYQAIKPYVDKLIGYASKLSPIFLIIDNVDQFEDDFIQSEIFSDSIAIA
FT                   SRLGINLIIAMRESTFINHRSSPTFDAFDFDPLHIEPPEIPAVLSRRFFLTGKLLEGKS
FT                   GEFIALNGANFKVEDLSVFIDIVKGSVLGTEVGEKIDVLSNHDVRLALRMTREFLARGY
FT                   TDPAKALITHKPEKRYTLPKQEAFRSILLGNQSVYSEEYSVIGNPFDSRLNRSNTELLR
FT                   IFVLSALVRKGSSNGQGYIEGQIIRDSLKTIGFSETDTLAILKDLCTLRFAHTKSHGKA
FT                   DINSSYFASRLGGHIIKSLIGDFTFIENILMDTFISEKDQWEQLKSISSSIQEERDIVR
FT                   KINQRIDRIKIFYELMISQYSILLSEATKRGLDPIWLSNPLIEMKDTLWSNCDKAYASA
FT                   NRIYGENAQK"
     gtggaaaaaa atgatacgtt tctaagtgac ttattaacaa cttataaaaa attaaaactc        60
     tctgatgcga atgaagcaga aacaagaaaa aagcttattg atgtagtaat tgaaaatgta       120
     ttaggttgga ctacagatga tatttcttat gaagaaagag tatctgaaga tggagaaaca       180
     acttatgcag attatattat tagaacagct gatgtttcta ttttaattga agcaaaaagg       240
     ctaggttcaa ctttttatac agttccagaa aagaaaaaag ttaagttatc tactttttct       300
     gaagatgatt taacaggtaa agctataaag caggcgagag aatattgtcg gaaaaagtct       360
     atcccttttg ctgctgttac taatggttca caatggatta ttttcccagc tgttagaacg       420
     gattcagttt cattctcgga ctctacagca ttggtatttg actcaatcga gcgaattcta       480
     ggagaagagt ctagtcattt tagaggttta ctttcacgtg acggagtaat tgaaggaaat       540
     ttagctttag aattgattgg tcgaaaaact gatcaatttg atgaaagaag acttaataaa       600
     ttttttaagg gaatttctat aaagaaagaa aaccctattt atccattgat tgaaggggct       660
     gttgtaagtg cattttctga ttcaattgtt gataatgata atagtattct agaaaaatgt       720
     tatgtaaaga atgctgatag gaaaaaattt gataatcgta tagaaatgca tttacaaaaa       780
     agagaacctc tttttaattc tcagcctaaa agacctatga gaaaaagaga gtcatctagt       840
     ttggttgatt caataaataa agcttcacac aataaaaaac cattagcaat attaattctg       900
     ggaactgtgg gaacagggaa aacaactttt ttgcaatata ctagacgaat atcatcagct       960
     agtttcttcg aacaaaaaga aaaacaacct tatccccact ggattgaaat agattttcga      1020
     acattttcca agaatgagaa tccactagac tttatatacg ataagttatt tgattatata      1080
     aagactgata aatttttttg tgattatgat aggtctatta agtttgcata tgaaaaagaa      1140
     attaactcat taaaatcagg tcctcttttc ctcctagcta atagtgatga agaattaaaa      1200
     aaaagaatta ctgatttatt aatagctgat tatcaagcta ttaaaccata tgtggataaa      1260
     ttgataggat atgcttcaaa actctctcct atttttttaa taatagataa tgtcgatcaa      1320
     tttgaagatg attttattca atcagaaatt ttttctgatt ctatagctat tgcaagtcgg      1380
     ctgggtataa atctcattat tgcaatgaga gaatctactt ttattaacca tagaagttcg      1440
     cctacttttg atgcatttga ttttgaccca ttacatatag aaccacctga aattccagca      1500
     gtattatcta gaagattttt tcttacagga aaattattgg aaggtaaaag tggagaattt      1560
     attgcactta atggtgcaaa ctttaaagtg gaggatctat ctgtatttat agatatagtg      1620
     aaaggttcgg tactaggtac tgaagttggt gaaaaaattg atgtattatc taaccatgat      1680
     gtacgcttag cattaagaat gactcgagaa ttccttgcta gaggatatac cgatccagcg      1740
     aaagctttga ttactcataa acccgagaag cgatatactt taccgaaaca agaagctttt      1800
     agatcaatac tattaggcaa tcagtcagta tatagtgaag aatattctgt tattggtaat      1860
     ccatttgatt cgagattaaa tcgttctaat actgagttgt tgagaatttt cgtattatct      1920
     gctttagttc gtaaaggatc atcaaatggt cagggttata ttgaaggtca aataattaga      1980
     gatagcttaa aaactatagg tttctctgaa actgatacac tagcaattct taaagattta      2040
     tgtactttaa gatttgctca tactaaatct catggaaaag ctgatatcaa tagtagttat      2100
     tttgctagtc gattaggtgg acatattata aagagtttaa ttggtgattt tacttttatt      2160
     gagaatatct taatggatac atttatatcc gaaaaagatc agtgggaaca attaaagagt      2220
     atttcatcat ccattcaaga agagcgggat attgtaagga aaattaatca aagaattgac      2280
     cgtataaaga ttttttatga attaatgata agtcaatatt ccattttatt aagcgaagca      2340
     acaaaaagag ggcttgaccc tatatggcta agtaatccat taattgagat gaaagatacc      2400
     ttgtggagta attgtgataa agcctatgct tctgctaaca gaatatatgg tgagaatgca      2460
     caaaaatag                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page