(data stored in ACNUC29543 zone)

EMBL: CP000521.PE814

CP000521.PE814       Location/Qualifiers
FT   CDS_pept        924610..925839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0780"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11220"
FT                   /protein_id="ABO11220.2"
FT                   /translation="MSWLSSLKSVFSPAQEVKEEEIQTVLQNYLLPDSKDALKERISQL
FT                   QVQGRVLQLTINTFPDEKEYLQQIHDDLAGALQKCGIEELNLHVVQQKRPTQESSGQGC
FT                   SSKAPKENSNLPPVLDASPKSEPDPNNPPIQKAAPQQRDVPLHPRIKNVILVSSGKGGV
FT                   GKSTTTVNLALALQKMGLKVGVLDADIYGPSIPTMLGNAGKTPLIESENFVPLDAYGMA
FT                   VLSIGHLTGDNNTPVAWRGPKATGALMQLFNQTLWPDLDVLMIDMPPGTGDIQLTLAQR
FT                   IPVTGSIIVTTPQNVALLDATKGIELFNKVGIPVLGVVENMSTHICSNCGHEEQIFGIG
FT                   GGDKLSEQYHIPLLGRLPLNAQIREHADQGKPSVIAMDDAADSYIDIAKAVWQQIEKIP
FT                   QRARDDKRIF"
     atgtcttggc tttcttcatt aaaatccgtt ttttcacccg cacaagaagt gaaagaagag        60
     gaaatccaaa ccgtactcca aaattattta ttgccagatt caaaagatgc tttaaaagag       120
     cgcattagtc agcttcaagt gcaaggtcgt gttttacaac tcaccattaa tactttccca       180
     gacgaaaaag aatacttgca gcaaattcat gatgatttag ctggcgcttt gcaaaagtgc       240
     ggtattgaag aacttaattt acatgtagtt caacaaaagc gccctacaca agagagttcg       300
     ggtcaaggtt gttcatctaa agcaccgaaa gagaattcga atttacctcc tgtgcttgat       360
     gcttcaccta agtctgaacc agatccaaat aacccaccaa ttcagaaagc agcgccgcaa       420
     caaagagatg tgccacttca tcctcgaatc aagaatgtta ttttagtttc atcaggtaaa       480
     ggtggtgttg gtaaatcgac aacaacggtc aatttagcgc ttgccttaca aaaaatggga       540
     cttaaggttg gggtattaga tgctgatatc tatgggccaa gtatcccgac catgctaggt       600
     aatgctggta aaactcctct tattgaaagt gaaaattttg taccgttaga tgcttacggt       660
     atggctgtac tttctattgg acatctaact ggcgataaca acacacctgt tgcatggcgt       720
     gggccgaaag ctacaggcgc tctaatgcaa ttatttaatc aaacgctttg gccagactta       780
     gatgtactca tgattgatat gccgccgggt acaggcgata ttcagctgac acttgcacag       840
     cgtattccag tgactggctc aatcattgtg acgaccccac aaaatgttgc tttgcttgat       900
     gcgactaaag gaatcgagtt gtttaataaa gttggtattc ctgtattagg tgtcgttgag       960
     aacatgtcga ctcacatttg ttcaaactgt gggcatgaag agcaaatttt tggtatcggt      1020
     ggtggtgata agctttccga gcaataccat attccattgc taggtcgttt gcctttaaat      1080
     gctcaaatac gtgagcatgc tgatcaaggt aaaccgagtg tgattgcaat ggatgatgca      1140
     gctgatagtt atatcgatat tgcgaaagca gtctggcaac agattgagaa aatccctcag      1200
     cgtgcacgag atgataaacg aatcttttga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page