(data stored in ACNUC29543 zone)

EMBL: CP000521.PE819

CP000521.PE819       Location/Qualifiers
FT   CDS_pept        929385..930725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11225"
FT                   /protein_id="ABO11225.2"
FT                   /translation="MRQFTSLQVAILALGSLCFSSAYAGSTLVPMTDAELSATRGQALM
FT                   SMSYIAPNDSANLEKLRDSSSNVGFFKLSLDADIELNTNIRKLQLGCGGANGAGACDID
FT                   IDNLSLSGLSNTNDGRASSSAKITNPFIEFAIKNPNSTALREVTGLRVSAEAIEGLLTF
FT                   GTENSQTKNGINSLSGYMEVAQAGGTVKVNPVNGLRPADVNNTQISGEACGYLACVPFQ
FT                   TYDYTLNLTTDAAGTSTDKLTGTLFLPQQTITGKRISVAPLKATATVSGINVSGNIKAI
FT                   AAGLLNLDKSVTGSINNLAVNVDISEDLGFFHKANLNGSPVSLSLQGNDIRWPGTKSVA
FT                   ERGWWLELSNPIDIGDITPAESVSIANKTIEETLALVSQKLSTGTRGNTKVDCGDLGLL
FT                   SCIGGSTINIGNLNLAGATPVQMSLSNLVLKNQTFATNCHGADVKFC"
     atgcgacagt ttacgtctct tcaggttgcg atattagcac tcggaagttt atgcttttct        60
     tcagcttatg ctggttctac attagttcca atgactgatg ctgagttgtc agctactcgt       120
     ggtcaggcct taatgagtat gtcttatatt gcgcctaatg attcggcaaa tctggaaaaa       180
     ttgcgtgata gcagtagtaa tgtaggcttc tttaaattaa gtttggatgc agatattgaa       240
     cttaatacta atatccggaa actccaactg ggctgcggtg gtgcaaatgg tgctggagca       300
     tgtgatatcg atatcgataa cttaagttta agtggtttat ctaatacaaa tgatgggcgt       360
     gctagttcat ctgcaaaaat tactaatccg tttattgagt ttgcaattaa aaatcctaac       420
     agtactgctt tacgtgaggt gacgggatta agagtaagtg ctgaggctat tgaaggttta       480
     ttaacatttg gtactgaaaa cagtcaaacg aaaaatggta ttaattcctt aagtggttat       540
     atggaagttg cacaagcggg gggtacagtt aaagtaaacc ctgtaaatgg tttgagacca       600
     gcagatgtaa ataatactca aatttctggg gaagcttgtg gctatttagc atgtgtacct       660
     tttcagactt atgactatac attgaactta acaactgatg cagctggtac ttcaacagat       720
     aagttaactg gaaccctatt tcttccacag caaaccatca ctggtaaacg tatttctgtg       780
     gcgcctttga aagcaacagc cactgtaagt ggtattaatg tgtctggtaa tattaaagct       840
     attgcagccg ggttattaaa tctagataaa tctgtaactg gttcaattaa taatttagct       900
     gtaaatgtag atatttcaga agatctagga tttttccata aagctaactt aaatggttcg       960
     cctgtttcat tgtctttaca aggaaatgat atacgctggc caggaactaa atcagtagca      1020
     gaaagggggt ggtggttaga gctttcaaat ccaattgata ttggagatat tactccagct      1080
     gaatctgtaa gtatcgcaaa taaaacaatt gaagaaactt tagcattagt aagtcagaaa      1140
     ttgagcacag gtacgagagg taatacaaaa gtagactgtg gtgatttggg acttctaagc      1200
     tgtattggtg gtagtactat taatattggt aacttaaatt tagcaggtgc aactccagta      1260
     caaatgtctt taagcaactt agttctaaaa aatcaaactt ttgccaccaa ttgtcatgga      1320
     gcagatgtaa aattctgtta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page