(data stored in ACNUC29543 zone)

EMBL: CP000521.PE820

CP000521.PE820       Location/Qualifiers
FT   CDS_pept        930944..932974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0786"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11226"
FT                   /protein_id="ABO11226.2"
FT                   /translation="MTTLNYTVRFQKTVLASLIGLFISQSSFALEELSDAGLSETTGEG
FT                   IAILPQNTYMVFRGAGANETTNQILTDRTKDTGYINYVPVGPLSMTAADTNKNGTIDSG
FT                   DRAVGKADIFLYGLALSKSDNDTNTRLASTEAAAAISSWGTAVNPWIFKVATENSVPNF
FT                   SATNCSGAADPTCQVTYLALEAPLYEVGTRDTAGLDAYKLKLGLWSDIFVRNPNKINGA
FT                   TDQFNYGDSNGLIGTSTDASRANRLRLQAIWNNFSLNGSRLQLFQTLGGATSAGGMSPF
FT                   YNDTLGFAGVIRLNSGDASNLRATITANTPTSTVGPWVNRYSTQYTGAPSNNSPSSDWL
FT                   YRIRSQTTTITSTGSWTAPTDSTMNNVLRLSTRESGTGQGNLITPAINGGLAPTFDANE
FT                   GLYLYNPNINLVLGSLYQPLVLSSDGKNFSLELARIPNKPEIYKKIYTDYTGNDSSYLG
FT                   STCNVYQCGKNVTLGGRTYQGSSATHSSISIGSTVYNATTNTLEAFKGNNTQDAVGISF
FT                   GKLPTGTVAATTQTRNFYQLQNQERRVNSYTCSLIFTCYDWQYRTATGWTGNAGSGLRF
FT                   DSQGAWANIDSTAYYNPTTNTTGYTTTDAGNGAQFVVPNGTPLPDALYNNARWYTTTPN
FT                   ADINTYKLSGAQISSSVSNNMGSAVIDGVLIQHLKLTTKGL"
     atgactacac ttaattatac ggtaaggttt caaaaaaccg ttttagcaag tttaattggt        60
     ctttttataa gccaatcgag ttttgctctt gaagaacttt ctgatgctgg tttgagtgaa       120
     actactggtg aaggtattgc tattttacct caaaatactt atatggtatt tcgtggagca       180
     ggagcgaacg aaaccacaaa tcaaatttta actgaccgta ctaaggatac aggctatatc       240
     aattatgtac ctgttgggcc gttaagtatg acggctgcag ataccaataa aaatggtacg       300
     attgattcgg gtgaccgtgc agtaggtaaa gctgatattt ttctttatgg tttagctctt       360
     tctaaatctg ataacgatac aaatacccgt ctcgcttcta ccgaggcagc agcggccatt       420
     tcgagttggg gtacggctgt taatccgtgg atttttaaag ttgcgacaga aaattctgtg       480
     ccgaatttca gtgcgacaaa ttgtagtggt gcagctgatc caacttgcca agtaacctat       540
     ttagctttag aagcgccttt atatgaagta gggacaagag atactgctgg gcttgatgcc       600
     tataaactta aattaggttt atggtcagat atttttgttc gaaatccaaa taaaataaat       660
     ggtgcgacag atcaatttaa ttatggtgac tctaatggtt tgatcggtac gagtactgat       720
     gcaagccgtg cgaatcgttt acgtttgcaa gctatttgga ataactttag tttaaacggt       780
     agtcgtctac agctcttcca aactttaggt ggtgcaacat ctgctggtgg aatgagtccc       840
     ttttataatg atacgttagg tttcgctggt gttattcgtt taaacagtgg cgatgcttct       900
     aatttaaggg caacaattac tgcaaatact ccaacctcta cagtagggcc atgggtaaac       960
     cgttatagta cccaatatac aggagcgcct agcaataatt cccctagttc cgattggtta      1020
     tatcgtattc gtagtcaaac gactactatt acttcaacag gttcatggac tgcgccaact      1080
     gacagtacaa tgaataatgt attgcgtttg agtactcgtg aatctggtac tggtcagggg      1140
     aatttaatta ctccagctat taatggaggg cttgcaccaa cctttgatgc aaacgaaggt      1200
     ttatatcttt ataacccgaa tattaatctt gtattagggt ctttatatca acctctagtt      1260
     ttgagttcag atggtaaaaa ctttagtttg gaactagcgc gtattccgaa taaacctgaa      1320
     atttataaga aaatttatac tgattatact ggtaatgata gtagttatct cggctctacc      1380
     tgtaatgttt accaatgtgg aaagaatgta actttaggag gaagaactta tcaaggttcg      1440
     agtgcaacac atagtagtat ctcaattggt tctactgttt ataatgcaac cacaaatact      1500
     ctagaggcat ttaaaggaaa taatactcaa gatgctgtag gtatttcttt tggaaaacta      1560
     ccaacaggaa cagttgctgc tacaacacaa actagaaatt tttatcaatt acaaaatcaa      1620
     gaacgtcgtg taaacagcta tacatgtagt ttaattttta cttgttatga ttggcaatac      1680
     cgtacagcaa caggctggac aggaaatgct ggttcaggct taagattcga ttcccaagga      1740
     gcctgggcga atattgatag tactgcttat tataatccaa caacaaatac gacaggttat      1800
     accactactg atgcggggaa tggtgctcaa tttgttgtac caaatggtac gcctttacct      1860
     gatgcactgt ataacaatgc acgttggtat acgactacac caaatgcaga tataaacacg      1920
     tataaattat cgggtgcaca gattagctct tcagttagta ataacatggg ttcagctgtt      1980
     attgatggtg ttttaattca gcatttaaaa ctgacaacta aaggtctcta a               2031
//

If you have problems or comments...

PBIL Back to PBIL home page