(data stored in ACNUC29543 zone)

EMBL: CP000521.PE824

CP000521.PE824       Location/Qualifiers
FT   CDS_pept        complement(937354..938277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11229"
FT                   /protein_id="ABO11229.2"
FT                   /translation="MEGLTDPIMRDTLTSVGHFDWCVTEFIRVTDSILPDHIYYSFCPE
FT                   LKNDGKTAAGTPVHVQFLGNNPEMLAANAAKVVELGAPAIDLNFGCPAKTVNRHRGGSV
FT                   LLDEPDVVHMLIKAVRDAVPAHIPVSAKMRLGYLDENHTMENAYAVEDAGASWLTVHAR
FT                   TKADGYTPPAYWEKILPIKEALKINVIANGEIWTNADARACQQQSGCEDLMIGRGAVTT
FT                   PDLTQCIRQNMDEALFTWEQLVDLQIRFLNGQAKTEIGMVGRYKQWLGMMTKAYPQAKE
FT                   LWDQVKRIKALDEIVQQLEQTSSSRI"
     atggaaggtt taactgaccc gatcatgcgg gatacactca catctgttgg tcacttcgac        60
     tggtgtgtaa ccgagtttat tcgcgttaca gacagtattt tgccagacca tatttactat       120
     agtttttgtc ctgaacttaa aaatgatggt aaaacagctg ctggaacacc tgtacacgtc       180
     cagttcttag gcaataatcc agagatgctg gcagcaaatg cggcaaaagt cgttgagctg       240
     ggtgctcctg caattgacct taattttggt tgtcctgcaa aaaccgttaa tcgacatcga       300
     ggtggttcgg tacttcttga tgaaccagac gtagtacata tgctgattaa agcagtccgt       360
     gatgcagtac ctgcgcacat ccctgtttca gcaaaaatgc gtttaggtta tctagatgaa       420
     aaccacacca tggaaaacgc ctatgctgtt gaagatgcgg gtgcaagctg gttaactgta       480
     catgctcgta ctaaagcaga tggttatacg ccaccagctt attgggaaaa aattctgcct       540
     attaaagaag ctttaaaaat taatgtgatt gctaacggcg aaatctggac caatgctgat       600
     gctagagctt gccagcaaca atctggctgt gaagatttaa tgattggccg tggtgcagtg       660
     actactccag atttaacaca atgtattcgc caaaatatgg atgaagcact gtttacttgg       720
     gaacaactgg ttgacttaca aatacgtttt ttaaatggtc aagcaaaaac agaaattggg       780
     atggttggcc gttataagca gtggttaggt atgatgacca aagcctatcc tcaagcgaaa       840
     gaattatggg accaagtgaa acgcattaaa gctttagatg aaattgttca gcagctagag       900
     caaaccagtt cttctcgtat ttaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page