(data stored in ACNUC29543 zone)

EMBL: CP000521.PE84

CP000521.PE84        Location/Qualifiers
FT   CDS_pept        97027..97536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10572"
FT                   /protein_id="ABO10572.2"
FT                   /translation="MTVILVKPHLRFKDSYNDYINELADEDRHPLTTEFDHTDFESFLN
FT                   KLRDYEKGESLEEGHVPNITYWLVEDNEVIGASNLRLKLNEQIEYCGGHIGLGIRPSKR
FT                   GQNFGSKLLELTIQEAWKLGLSELHIHCYKYNLASAKTIQANNGRLHSEITLNQVVQRY
FT                   VVYKTL"
     atgaccgtta ttttggtaaa acctcatttg agatttaaag acagctataa cgactatatc        60
     aatgaattag cagatgaaga tcgccaccct ttgacaacag agtttgacca tacagatttt       120
     gaaagttttt tgaataaact aagagattat gaaaaagggg agtccctaga agaagggcat       180
     gttcccaaca ttacatattg gttagtagaa gataatgaag ttattggtgc atctaacttg       240
     cgccttaaac tcaatgaaca gattgaatat tgtggtgggc atattggttt aggtattcgt       300
     ccctctaagc gtggacagaa ttttggctcg aaattgttgg aacttacaat tcaggaagca       360
     tggaaactag gcttatcaga gttacatata cattgctata aatataattt agcttctgca       420
     aaaaccattc aagcaaacaa tggtcgtctt cattccgaaa ttactctcaa ccaagtagtt       480
     caaagatatg tggtatataa aactctataa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page