(data stored in ACNUC29543 zone)

EMBL: CP000521.PE85

CP000521.PE85        Location/Qualifiers
FT   CDS_pept        complement(97896..98132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3486"
FT                   /old_locus_tag="AS1_3486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89911"
FT                   /protein_id="ABS89911.2"
FT                   /translation="MGISGCNLHTQQEFEKICLSGGHSKTSCECIYQRLEQTYSPKLMQ
FT                   RLEHVSLQSPVLPQDFAPTFLSTMQRCDKSSLG"
     ttgggtattt caggctgtaa cctccacact cagcaagagt ttgaaaaaat ttgcctatcg        60
     ggtgggcata gcaagaccag ttgcgaatgt atttaccagc gacttgaaca aacctattcc       120
     ccgaagctta tgcagcgcct agaacatgtc agtttgcaaa gtcctgttct cccacaggac       180
     tttgccccta cttttttaag caccatgcag cgatgtgaca aaagtagtct gggctaa          237
//

If you have problems or comments...

PBIL Back to PBIL home page