(data stored in ACNUC29543 zone)

EMBL: CP000521.PE87

CP000521.PE87        Location/Qualifiers
FT   CDS_pept        complement(100092..100784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0081"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10574"
FT                   /protein_id="ABO10574.2"
FT                   /translation="MKIKKSAFYIFTMIFSLHSSAFAEPSVADVQYRAQQGQPIAQYHL
FT                   GIMLLTGEQGVVKNYEQAFKWLTAADQNGSVGAKYSLGMMYFTGTGVEKDMKRAFEYFA
FT                   KAADKGHAKAQYNLGVLYDRGEGTAQNYEQAFEWYSRAAEQGYPPAEYNLAHLYKKGHG
FT                   VAQSDEQALKWYTKAAEHNESDAQYNLAQMYLNGEGTPKNLQLAKKWFQQAADAGDSDA
FT                   KEMLKSLD"
     atgaaaataa aaaagtctgc tttttatata tttaccatga ttttttcgct tcattcttca        60
     gcatttgctg agccgagtgt tgctgatgtt caatatcgtg cacagcaagg acaaccgatt       120
     gcgcaatatc atcttggcat catgctttta actggtgaac aaggtgttgt taaaaactat       180
     gaacaagctt ttaaatggtt aactgccgct gaccaaaatg gcagcgtggg ggcaaaatat       240
     agtttaggaa tgatgtattt cacgggtaca ggcgtagaaa aagacatgaa acgcgctttt       300
     gaatattttg ctaaagctgc ggataagggc catgccaaag cgcaatataa cttaggggtg       360
     ttatatgaca gaggtgaagg aactgcgcaa aattatgagc aggcttttga atggtatagt       420
     cgtgctgcag agcaaggcta tccgcccgca gaatataatt tagctcatct atataaaaaa       480
     ggtcacggcg tcgctcaaag cgatgagcaa gcccttaagt ggtacaccaa agcggctgag       540
     cataatgaaa gcgatgccca gtacaacttg gcccagatgt atttaaatgg tgaaggcacg       600
     ccgaaaaacc tacaactggc aaagaaatgg ttccagcaag ctgccgatgc aggtgattcg       660
     gatgcgaaag aaatgcttaa aagtttagat taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page