(data stored in ACNUC29543 zone)

EMBL: CP000521.PE90

CP000521.PE90        Location/Qualifiers
FT   CDS_pept        108043..108744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10577"
FT                   /protein_id="ABO10577.1"
FT                   /translation="MENKNQCRQCAVCGKSFPLKDLVSGEVIRNVISDEILKDHPDWSY
FT                   SSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQRHELISRNTESDFDQNWTF
FT                   GEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVIVVRPVDPYPFILLNLVLSCLAAI
FT                   QAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEKMDHLLSHQWERLAHIQEIQ
FT                   LDLLAEMNKKR"
     atggagaata aaaatcagtg tcgccaatgc gctgtatgtg gaaagagctt tcctttaaaa        60
     gatttagtat ctggtgaagt catccgtaac gtgattagtg atgaaatttt aaaagaccat       120
     ccagattgga gttactcaag ctttatttgt cgggccgatc tggcagatta tcgaattaaa       180
     tatgtgcagt ccctattacg ctcggaaaag ggtgagttat ctaacctaga aaatgaagta       240
     attggcagta tgcaacggca tgaattaatt agccgaaata cagagtcaga ttttgatcaa       300
     aactggacgt ttggagaaaa actggcagat aaaatcgcat catttggtgg tagctgggct       360
     tttcttattt gttttgcttt atttttaacg gggtggattg ttttaaatac ggttgtgata       420
     gtggtccgtc ccgtcgaccc ttatcctttt attttgctga atttagtgtt gtcatgttta       480
     gctgcaattc aagcacctat tattatgatg agtcaaaacc gtcaagaagc aaaagaccgt       540
     ttgcgttccc aacatgacta tcaaattaat ttaaaagccg agcttgagat tcgtcattta       600
     catgaaaaaa tggaccatct tttatcgcat cagtgggaaa ggcttgcaca tattcaagaa       660
     attcagctcg atcttttagc tgaaatgaat aaaaaacgat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page