(data stored in ACNUC29543 zone)

EMBL: CP000521.PE92

CP000521.PE92        Location/Qualifiers
FT   CDS_pept        109631..110005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10579"
FT                   /protein_id="ABO10579.2"
FT                   /translation="MNRDYEQFPDDDNGNVLWQMVEDGDDLTELHEIEFSIAFQDQQNA
FT                   EQCAMHLLYQEQKISLFQDDSVEPNEWIITIFVTMEPEYSDIVDLEQWFSTIAEQFNGE
FT                   YDGWGCMAYVFDEEEDDILQ"
     atgaaccgcg attacgaaca atttccagat gatgataacg gcaatgtact ttggcaaatg        60
     gttgaagacg gggatgattt aaccgagctt catgaaattg aattttcaat tgcatttcaa       120
     gatcaacaaa atgcagagca atgcgcgatg catttactct atcaagagca aaaaatttct       180
     cttttccaag atgattctgt tgaaccgaat gaatggatca ttaccatctt tgttacgatg       240
     gaaccagagt attcagatat tgttgatctg gagcagtggt tttcaacaat cgctgagcaa       300
     tttaacggcg aatatgatgg atggggctgc atggcttatg tcttcgacga agaagaagat       360
     gacattttac aataa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page