(data stored in ACNUC29543 zone)

EMBL: CP000521.PE94

CP000521.PE94        Location/Qualifiers
FT   CDS_pept        complement(110459..112432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0092"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10581"
FT                   /protein_id="ABO10581.2"
FT                   /translation="MSQNSSATKFTHDVLDVPFNRAYLSKQIMEQQDVQRIDDALTLVS
FT                   GVFHQNSFGGGFWDNYSFRGFSTDPNLGAAMIRNGLSVNRGINAPKDVVNIESLEFLKG
FT                   PMAALYGRGETGGLLNLNSKKPQWESESELNLRANTQEQYRISLEHTAPINDELAYRLA
FT                   VAHEDNQSFRDHVSSERWFFSPQLTWKISDQTQLDFDSEFTEHKGTFDRGVSTVNHQFV
FT                   MDPKTFTGEPDDGDLKIKDYFYQLRLSHEFNPDWKLNSAVSYKDAKMVGFATEPRRMQA
FT                   DGRTLERQRRYRDYTSEDVLAQTELLGKIDTSWARHEILLSTELGQLDYKQNQLRRNHD
FT                   SNSPTTVNTIDIYQPEYGKYLPNLTPFTDTKERQRYFAFNVQDQIFFNDQWSVLFGNRF
FT                   DQVEQDFKNHIKQTEDNQTLHQNSPRFGVNFKASEQWAFYTNYGRSFAMNSGMNRNGQT
FT                   FAPEKGKSYEVGTKYKINDQSVLSLALFKMKKQNVLTTDPIDKDFQTAAGELSSKGVEF
FT                   DLNSQINDRWFVNANYSYTDAQIEKDQDLAKGARLSNVPKHQGSVSTNYEFLQDGARKA
FT                   GVGANLTYVGERSGHNLDNGFNLPSYTLVNLNGYYAPSDRLRYQLNINNLFDKTYYVSS
FT                   YSDLWVQPGEPLNASISAQWKF"
     gtgagccaaa atagctcggc aactaaattt actcacgatg ttttagatgt cccttttaac        60
     cgtgcttatc tttctaaaca aataatggaa cagcaagacg tgcaacggat tgatgacgca       120
     ttaactttag tcagtggggt ttttcatcaa aatagttttg gtggtggttt ttgggataac       180
     tactcatttc gtggctttag taccgacccc aatttaggtg cggctatgat ccgtaacggt       240
     ttgagtgtta accgaggaat taatgctcca aaagatgtag taaatattga atctttagaa       300
     tttttaaaag gaccaatggc ggcgctatat ggtcgcggcg aaacaggagg tttgctgaac       360
     ctcaacagta aaaaaccaca gtgggaaagc gaaagtgaac ttaacctacg tgccaatacc       420
     caagaacaat atcgaattag tctggagcat accgcgccta ttaacgatga actcgcctat       480
     cgtttagcag tggctcatga agataatcaa agcttccgtg atcatgtcag cagtgaacgc       540
     tggttctttt caccacagct tacatggaaa atttcagacc aaacgcaact cgactttgac       600
     agtgaattta ctgagcataa aggaaccttt gaccgtgggg tcagcacagt caatcaccag       660
     tttgtgatgg acccgaaaac ctttacaggt gagcctgacg atggtgatct gaaaataaaa       720
     gattactttt accaattacg tctaagtcac gagtttaatc ctgactggaa actaaatagt       780
     gcggtcagct ataaagacgc caaaatggtc ggctttgcaa ccgaacctcg gcgtatgcaa       840
     gccgatggac gtactttaga acgtcaacgt cgctatcgtg attatacaag tgaagatgtt       900
     ctggctcaga ccgagttact tggcaagatt gatacttcgt gggctcgcca tgaaatttta       960
     ctttcaaccg agcttggtca actcgactat aagcaaaacc agcttcgtcg caaccatgac      1020
     tcaaactcac ctactacagt aaacacaatt gatatttacc aacctgaata cggcaaatat      1080
     ttaccgaatc tcactccgtt taccgacacc aaagagcgcc agcgttactt cgcgtttaat      1140
     gtacaagatc agatcttttt caatgaccag tggagtgtgc tatttggcaa ccgttttgat      1200
     caggtcgaac aagactttaa aaatcatata aaacagaccg aagacaacca aacacttcac      1260
     cagaatagtc cacgtttcgg agtaaatttt aaagcctctg agcaatgggc gttttataca      1320
     aactatggtc gctcatttgc catgaatagt ggtatgaacc gaaatggaca aaccttcgct      1380
     cctgaaaaag gcaaaagcta tgaagttggc accaaatata aaataaacga ccaaagtgtg      1440
     ctgagtctcg ctctgtttaa aatgaaaaaa cagaacgtgc taacgacaga cccaatcgac      1500
     aaagactttc aaaccgcagc aggcgaattg agcagtaaag gagttgaatt tgacttaaat      1560
     agccagatca atgaccgctg gttcgttaat gccaactata gttataccga tgctcaaatt      1620
     gaaaaagacc aagacttggc aaaaggcgct cgtctaagca atgttccaaa acaccaaggc      1680
     tccgtaagca ccaattatga gtttctacaa gacggtgcaa gaaaagcagg tgtaggtgcc      1740
     aatctcactt atgtaggtga gcgcagtgga cataaccttg ataatggctt taacttaccg      1800
     agttatacgc tggtcaattt aaatggctac tatgccccat ctgaccgctt acgctatcag      1860
     ctgaatataa ataacctatt tgataagacc tactatgtct caagctatag cgatttatgg      1920
     gttcaaccgg gcgaaccatt gaacgcctca atttcggcac agtggaagtt ttaa            1974
//

If you have problems or comments...

PBIL Back to PBIL home page