(data stored in ACNUC29543 zone)

EMBL: CP000521.PE95

CP000521.PE95        Location/Qualifiers
FT   CDS_pept        112634..113779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0093"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10582"
FT                   /protein_id="ABO10582.2"
FT                   /translation="MSLEKNIERLQSIDALRGLVIIIMLLDHVRETFYLHKQVTDPMDV
FT                   TVTEPALFGSRLLAHICAPVFVLLTGISAFLFQSKKQDLQQTRAFLLKRGLFLIVLELT
FT                   LVNFAWTATFPPEVIYLQVIWAIGISMVVLACCVSLPLPVLAGVALVIIFGHNLLDSVH
FT                   FSQGILQNIWFVLHERGWLEFAGIKLRTSYPVLPWIGVILLGYVLGQFFNSKYTAKQRS
FT                   RTLLSLGLASIGLFVLLRFINVYGDQPWQHFESLQLSLMSFFNLTKYPPSLLFILLNVG
FT                   IGLLVLVAFERMQQYSFLKPLVVFGSVPMFFYLLHLYVLKLMYVFALSVWGANYGNYLS
FT                   VNHVWMLWLITIVLSFALYPAVKWFSKFKHQNKHISILKYF"
     atgtctttag aaaagaatat tgaacgttta cagtcgattg atgcattgcg tggtttggtg        60
     atcatcatta tgttgctcga ccatgtaaga gaaactttct atttacataa acaggttacc       120
     gacccaatgg acgtaacagt aacagaaccg gctttatttg gcagtcgatt attggcccat       180
     atctgtgctc cggtttttgt acttttaacc ggtatttctg catttttatt tcaatcaaaa       240
     aaacaggact tacagcaaac acgtgccttt ctattgaaac gtggcttatt tttaattgtg       300
     ttagagctta cgctggtgaa ctttgcatgg acagcgactt ttccacccga agtcatttac       360
     ttacaggtga tttgggcgat tggtattagc atggtggtgc tagcttgttg tgtaagtttg       420
     cctttgcctg ttcttgcagg tgtagcgttg gtgattattt ttgggcacaa cttattagat       480
     tctgtgcact tctcacaagg catcctacag aatatatggt tcgttttaca tgaacgtggc       540
     tggcttgagt ttgcgggtat caagcttcgt acaagttacc ctgttttacc ttggattggg       600
     gtgattttat taggctatgt attaggtcag ttctttaatt caaaatatac agcaaagcaa       660
     agaagccgca ctttactcag tcttggttta gctagtatcg ggttatttgt cttactgcgt       720
     tttatcaatg tctatggcga ccagccgtgg caacattttg agtcattaca actgagcctc       780
     atgagctttt ttaacctcac caagtatcca ccgtctttat tgtttatttt gctaaatgtt       840
     ggaattggtt tgcttgtgct cgttgctttt gaacgtatgc agcaatattc atttctaaaa       900
     ccattggtcg tgtttggttc ggtgccgatg ttcttttatt tattgcactt atatgtattg       960
     aaactgatgt atgtgttcgc actcagtgtg tggggagcta actacggaaa ctatttgtcg      1020
     gtcaatcatg tgtggatgct gtggttaatc acgattgtgt tgtcttttgc actctatcca      1080
     gcggttaaat ggttctcgaa atttaaacat caaaacaagc atatttcgat tttaaaatat      1140
     ttctaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page