(data stored in ACNUC29543 zone)

EMBL: CP000521.PE97

CP000521.PE97        Location/Qualifiers
FT   CDS_pept        114424..115689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0095"
FT                   /product="D-amino acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10584"
FT                   /db_xref="GOA:A3M0Z0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0Z0"
FT                   /protein_id="ABO10584.2"
FT                   /translation="MRVIVLGSGVIGVASAYYLARQGAEVTVLDRQSGPAEETSFGNAG
FT                   QISPGYSTPWAAPGIPFKAVKWMFQHHAPLAINLDGSMWQLQWMAQMLKNCNPQSYAVN
FT                   KERMMRVAEYSRDCLRELRKDTGIHYENRAKGTLQLFRKEAQMEAVQRDISVLEECGVS
FT                   YELLNANELGRVEPALANAQDKLVGGLHLPNDETGDCYLFTNALAQIAKELGVNFQFNQ
FT                   NVEKLIVEGDQIKGVQVNGKILTADRYVLAFGSYSRDFLKPLDLQLPVYPVKGYSLTIP
FT                   IVDPAFAPQSTVLDETYKIAITRFDQRIRVGGMAELSGFNLGLNEDRRATLQMVTQDLF
FT                   PGGDMEQASFWTGLRPMTPDSTPIIGATRFKNLFLNTGHGTLGWTMACGSGKLISDIVL
FT                   NHKTDISTDGLSIQRYSHAHAA"
     atgcgcgtaa ttgtactagg tagcggcgtt attggagtgg caagtgccta ttatctggct        60
     cgacaaggag ccgaggttac tgttctcgat cgccagtcag gtcctgctga agaaacaagt       120
     tttggtaatg caggtcaaat ttcgcctggg tattcgaccc cttgggcagc accaggaatt       180
     ccttttaaag ctgtgaaatg gatgttccaa caccatgcac cgcttgcgat taatttagat       240
     ggcagcatgt ggcaattaca gtggatggcg caaatgctga aaaactgtaa tccgcaaagt       300
     tatgctgtga acaaagaacg tatgatgcgt gtggctgaat atagtcgtga ctgcttacgt       360
     gaacttagaa aagacacggg tattcactac gaaaaccgcg ctaaaggtac gttgcagtta       420
     ttccgtaaag aagcacaaat ggaagcggtt caacgcgaca ttagcgtgct tgaagagtgt       480
     ggcgtaagct acgaattatt aaatgctaat gaactcggtc gtgtagagcc tgctttggca       540
     aatgctcaag ataaactcgt gggtggttta cacttaccaa atgatgaaac aggcgactgc       600
     tatttattta ccaatgcttt agctcaaatt gctaaagagc taggcgttaa tttccagttt       660
     aaccagaacg tagaaaaatt gattgtcgaa ggcgatcaaa ttaaaggcgt acaggtcaat       720
     ggtaaaattt taactgcaga tcgttatgtt ctagcgtttg gtagctattc acgtgatttc       780
     ttgaaaccgc ttgatctaca gttacctgta tatcctgtga aaggttactc gttgacgatt       840
     ccaattgttg acccagcttt tgctccgcaa tctacggtgc ttgatgaaac ctacaaaatt       900
     gcgattacgc gttttgacca acgtattcgc gtaggtggta tggctgagct aagtggcttt       960
     aacttaggtc tgaacgaaga ccgccgtgca accttgcaaa tggtgacgca agatttgttc      1020
     ccaggtggtg atatggaaca agcatctttc tggacgggtt tacgtccaat gacgccagac      1080
     agtactccaa ttattggtgc gactcgcttt aaaaatctgt tcttgaatac aggtcatggc      1140
     actttaggtt ggaccatggc gtgcggttca ggaaaattaa tcagtgacat cgtattgaat      1200
     cataagactg atatcagtac cgatggcctt tcaattcagc gttattcaca cgcacatgcg      1260
     gcttaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page