(data stored in ACNUC29543 zone)

EMBL: CP000521.PE99

CP000521.PE99        Location/Qualifiers
FT   CDS_pept        116824..117183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10586"
FT                   /protein_id="ABO10586.1"
FT                   /translation="MSNSDIQKINTNEVMSAVTVFNKVVYLSGQVPKNTEQDVAGQTRE
FT                   ILATIDELLALANTDKSRLLSAQLYLKNLSDFSTVNAIWVDWLKGCVAPSRATIQADLV
FT                   NPNWLIEIAVTAAQK"
     atgtctaatt cagatataca aaagattaac actaacgaag tcatgagcgc cgtgactgtt        60
     tttaacaaag tggtttattt gtcaggtcag gtgcctaaaa ataccgagca agacgtggca       120
     ggacaaaccc gtgaaattct tgcaacaatt gatgaacttt tggcgttagc caataccgat       180
     aaatctcgtt tgctctctgc gcagctctat ttgaaaaatc tttctgactt ttcaaccgta       240
     aatgcaattt gggttgactg gttaaaaggg tgtgttgctc catcgcgtgc cacaattcag       300
     gccgatttgg tcaatccaaa ttggttaatt gaaattgccg tgacggcagc acaaaagtaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page