(data stored in ACNUC7421 zone)

EMBL: CP000529.PE1

CP000529.PE1         Location/Qualifiers
FT   CDS_pept        2826..3659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35328"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI50"
FT                   /protein_id="ABM35328.1"
FT                   /translation="MDWSREEVEAIVADYLQMLTMELAGQSFNKTQHRRWLQGKLNGRS
FT                   DASIEFKHCNISAAMIDLGFPYIRGYQPRSNYQALLAIVAEEQVRGKITLDHAALAAVQ
FT                   QPAVVPTQTDFTKVKSEAPKKQHQAKEAVNPLLFRAVKRDYLEREAQNSSLGLAGEEFV
FT                   VQFEHWRLVGMGQHRLADRVEHVSVSKGDGLGYDVLSFESDGRERLIEVKTTTFGRDTP
FT                   FFVSRGELALSQGAKDQFHLYRLFEFRKSPRLFDLPGSLDQHCLLDPVTYRASFG"
     atggattggt cacgggaaga agtagaagcc atcgtcgcgg actacctgca aatgctgacg        60
     atggaactcg ctggacagag cttcaacaag acccagcatc ggcgctggct gcaaggcaag       120
     ctcaatgggc gttctgatgc ttccatagag ttcaagcact gcaatatcag cgcggccatg       180
     attgaccttg ggtttccata cattcgaggt tatcaaccgc gctctaacta ccaggcgctc       240
     ctggcgatag ttgcagagga gcaggtgcgc ggcaaaatta ccttggatca tgctgcactg       300
     gcggccgtgc agcagcctgc cgtcgtaccc acccagaccg acttcacgaa agtgaagtcg       360
     gaagcaccga aaaaacagca tcaggccaag gaagcggtaa accccttgct tttcagggct       420
     gtaaagcgcg actaccttga acgcgaagcc caaaacagct cgctgggctt ggcgggggag       480
     gaatttgttg ttcaattcga gcattggcgt cttgttggga tggggcaaca tcgactcgcc       540
     gacagagtcg agcatgtttc cgtatcgaaa ggcgacggtc ttggctacga cgtgctctca       600
     ttcgaatccg atggcaggga gcgcttgatc gaagtcaaaa caaccacctt tgggcgggac       660
     acgccatttt tcgtttcgcg aggtgaattg gctctgtccc agggagcaaa agaccagttt       720
     cacctttatc gtttgttcga gttcagaaaa tcccctcgcc tgtttgatct cccaggatca       780
     cttgatcaac actgtctttt ggacccagtg acctacagag ccagttttgg ttag             834
//

If you have problems or comments...

PBIL Back to PBIL home page