(data stored in ACNUC7421 zone)

EMBL: CP000529.PE10

CP000529.PE10        Location/Qualifiers
FT   CDS_pept        9140..9574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0011"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   bxe:Bxe_B2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35337"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI59"
FT                   /protein_id="ABM35337.1"
FT                   /translation="MNNDPAIHVLRLNPGDDLRAELQSAFNALQARGCRAACVISAVGS
FT                   LSRAVLRHAAQAQASVQNEPLELITLSGTLSPDGVHLHASVADARGEMRGGHVMPGCSV
FT                   RTTAEIVLALLPGWAFSRAHDDRSGFMELVATPASSKNPD"
     atgaacaacg atcccgccat ccatgtcctg aggctgaacc ccggcgacga cctgcgcgcc        60
     gaactgcaat cggccttcaa cgcgctgcag gcccggggct gccgggccgc ctgcgtcatc       120
     tcggccgtcg gcagcctgtc gcgcgccgtg ctgcgccatg cggcccaggc gcaggcaagc       180
     gtgcagaacg agccgctgga actcatcacc ctgtcgggca cgctgagccc ggacggcgtg       240
     cacctgcatg ccagcgtcgc cgatgcccgg ggcgaaatgc gcggcggtca tgtcatgccg       300
     ggctgcagcg ttcgcaccac ggctgaaatc gtgctggcgc tgctgccggg ctgggcgttc       360
     agccgcgcgc acgatgatcg gagcggcttc atggagctgg tggcgacgcc cgccagctca       420
     aaaaatccag actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page