(data stored in ACNUC7421 zone)

EMBL: CP000529.PE101

CP000529.PE101       Location/Qualifiers
FT   CDS_pept        complement(110417..110683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35428"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF0"
FT                   /protein_id="ABM35428.1"
FT                   /translation="MFCISFEGHDVATDGDVLKMALPGNRGENNNDTISRQNQLPRFLH
FT                   EWPPRLEAAQSLISKNVPALTRAKRGHWPAFIEITLFTLEFSR"
     atgttttgca tatcttttga gggtcatgat gtggcaactg atggtgatgt tcttaaaatg        60
     gctcttccgg gcaatcgtgg agagaacaac aacgacacca tcagccgcca gaaccagctc       120
     ccccgtttcc ttcatgaatg gccgcctcgc cttgaagcgg cgcaaagtct tatttcgaaa       180
     aacgtcccgg ccttgacgcg tgccaagcgc ggtcattggc cggcgtttat cgaaatcacg       240
     ctttttactt tggagttttc acgatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page