(data stored in ACNUC7421 zone)

EMBL: CP000529.PE103

CP000529.PE103       Location/Qualifiers
FT   CDS_pept        112533..113192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0105"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: corR; DNA-binding response regulator CorR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35430"
FT                   /db_xref="GOA:A1VIF2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF2"
FT                   /protein_id="ABM35430.1"
FT                   /translation="MPNSFIEPPTVLLVDDHTLFREGMRLMLGSSPLVHAHILDAGNLP
FT                   DALALQQSVDLVLLDIGLPGIGGLEGLLSVRQRWPDAVIVMLSAHDRPELVREALSKGA
FT                   CGFVSKTAQPVQICQEVRRWLYQQRGPEPQPQALPGEAAAGAIPGGDESLTPRQYEVLK
FT                   LLAQGLSNKAIAFKLHLSEHTIRNHVVAILRHFNALTRTEAVMASQRLGLLPATLI"
     atgccaaatt cgttcattga gccgcccacg gttttgctgg tggacgatca cacgctcttt        60
     cgcgaaggca tgcgcctcat gctcggcagc agcccgctgg tgcatgccca catcctggat       120
     gccggcaacc tgcctgacgc cctggcgctg cagcagtcgg tggatctggt gctgctcgac       180
     atcggcctgc cgggaatcgg gggactggaa ggtctgctaa gcgtcaggca gcgatggccg       240
     gacgccgtca tcgtgatgct gtcggcccac gacaggcccg agctggtgcg cgaagccctg       300
     agcaagggcg cttgcggttt tgtttccaag accgcccagc cggtgcagat ttgccaggaa       360
     gtgcggcgct ggctgtatca gcagcgcggc cccgagccgc agccgcaggc tttgcccggc       420
     gaggctgcgg ccggcgcaat tccgggaggc gacgagagcc tgacgccgcg ccagtacgag       480
     gttctcaagc tgctggcgca agggctgagc aacaaggcga ttgctttcaa gctgcacctg       540
     agcgagcaca ccattcgcaa ccatgtggtc gccatcctga ggcacttcaa tgcgctaacc       600
     cgcaccgagg ccgtgatggc ttcgcagcgt ctcggacttc ttcccgcaac cctgatttaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page