(data stored in ACNUC7421 zone)

EMBL: CP000529.PE104

CP000529.PE104       Location/Qualifiers
FT   CDS_pept        113225..115198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0106"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: rme:Rmet_4855
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35431"
FT                   /db_xref="GOA:A1VIF3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF3"
FT                   /protein_id="ABM35431.1"
FT                   /translation="MVPGAPGPAATAGTGPQALRHLSVLDSQLQLINANIYAALLGSGL
FT                   TGCLLTWLVWLVNPDPLSGSWIEQGQRFVAWLAAGNYSVSAAGFEGVAVLRLHSASWLL
FT                   AYLLVSLACALIWRYFWRRTGSIYSVEQTYRLLQALALAVGLCWGIGCGWLYQPESSAV
FT                   TLGMVSLMGGLSGGLLSGVGVRARLYWLVSLPMAVGLVGALLYHGGEVNPVLPVALLLL
FT                   LLSNGIFAHNTERHIGSTIELRFKNMFLVEQLREQTRVAEQANLAKSNFLAGASHDLRQ
FT                   PVHALNLFLESLSTTRLDARQETIVTHARAASLASREMLDTLLDFSRIEAGVMEPKPRT
FT                   MPLAGLLRQLEDEYGPQADSKGLVYRSRDCIDHVYCDPSLLSLILRNLVGNAIRYTVRG
FT                   GVLVAVRTRGTDKVVEVWDTGIGIDASHHEKIFHEFHQISNQERDHHKGLGLGLAIVRR
FT                   LVDSLGLELSLASRLGKGSVFSLRLPCASPPCQPAGVNALVSPTFQPGAARHEASSLMG
FT                   LRVLVVDDEVLVREGMRMLLGQWGCFVEVFRTVEGATRYIGDFDGDGPPFDLLITDFRL
FT                   ENGVTGHDVIRAVRAALQKLPDFADFDPPVVIVTGDTDPLRISQARGLGATVLHKPIDT
FT                   QVLHAELAKAFAFKTSKNLLLI"
     atggtgcccg gcgcgccagg gccggccgcg acagccggca cgggtccgca agccttgcgc        60
     cacctgtccg tgctggactc gcaattgcag ctcatcaatg caaatattta cgctgcattg       120
     ctcggcagcg gcctgaccgg ctgtttgctg acctggctgg tgtggctggt caatccagac       180
     cccctgagcg gcagctggat cgaacagggg caacggtttg tggcctggct tgctgccggg       240
     aattacagcg tatccgccgc aggcttcgag ggggtcgcgg tgttgcgcct gcattcggca       300
     agctggctgc tggcctattt gctggtgtcg ctggcgtgcg cgctgatctg gcggtatttc       360
     tggcggcgaa ccggcagtat ttacagcgtt gagcaaacct accgcctgct tcaggccctg       420
     gcgctggcgg tcggcctgtg ctggggcatc ggttgcggct ggctgtacca gcctgaatcc       480
     agcgcggtga ccttgggcat ggtgagcctg atgggcgggc tgtccggcgg actgctctcc       540
     ggggtcgggg tgcgcgcacg gctttactgg ctggtcagcc tgcccatggc ggtcggactg       600
     gtgggcgcac ttttgtacca tgggggcgag gtcaaccccg tgctgccggt tgcgctgctg       660
     ctgttgctgc tcagcaacgg tatttttgcg cacaacaccg agcgccacat cggcagcacc       720
     atcgagttgc gctttaaaaa catgttcctc gttgaacagc tgcgcgagca gacccgcgtg       780
     gccgagcagg ccaacctggc caaaagcaac ttcctggccg gtgccagcca cgacctgcgc       840
     cagcccgtgc atgcgctcaa ccttttcctc gaatcgctta gcaccacccg gctcgatgcc       900
     aggcaggaaa ccatcgtcac gcacgcccgg gccgccagcc tggcgagtcg cgaaatgctc       960
     gacacgctgc tggatttttc ccgcatcgag gccggggtga tggagcccaa gccgcgcacc      1020
     atgcccctgg cgggactgtt gcggcagctt gaagacgaat acggtccaca ggccgacagc      1080
     aaggggctgg tttaccgaag ccgcgactgc atcgaccatg tttactgcga tccgtcgctg      1140
     ctgtcgctga ttttgcgcaa cttggtcggc aatgcaatcc gctacaccgt gcgcggcggc      1200
     gtgctggtgg ccgtgcgcac gcgcggcacc gacaaggtgg ttgaggtctg ggacaccggg      1260
     atcggcatcg acgcctcgca ccatgagaaa atctttcacg agttccacca gatatccaac      1320
     caggagcgcg accatcacaa aggcctggga ctgggcctgg ccatcgtcag gcggctcgtc      1380
     gatagcctcg ggctggagtt gtcgctggcg tcccggctgg gcaagggcag cgtgttttcg      1440
     ctgcggctgc cgtgcgcgag cccgccttgc cagcccgctg gcgtcaacgc cttggtctcg      1500
     ccgacctttc agcccggcgc ggcgcggcat gaggcctcgt ccttgatggg cttgcgggtg      1560
     ctcgtggtgg acgacgaggt gctggtgcgc gaaggcatgc gcatgctgct gggccagtgg      1620
     ggctgcttcg tggaggtgtt cagaaccgtt gagggcgcga cccgctacat cggcgatttc      1680
     gacggcgacg gcccgccatt cgatctgctg atcaccgact tccgcctgga aaacggcgtg      1740
     accggccacg atgtcatccg ggcggtgcgg gccgcgcttc aaaagctgcc ggacttcgcc      1800
     gatttcgacc cgccggtggt catcgtcacc ggcgacaccg acccgcttcg catttcgcag      1860
     gcgcggggcc tgggcgccac cgtgctgcac aaaccgattg acacgcaggt tctgcatgcg      1920
     gaactcgcca aggcatttgc cttcaagacc agcaagaatt tgctattaat ttaa            1974
//

If you have problems or comments...

PBIL Back to PBIL home page